AV13012

Sigma-Aldrich

Anti-CHML antibody produced in rabbit

affinity isolated antibody

Sinónimos:
Anti-Choroideremia-like (Rab escort protein 2)
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

forma del anticuerpo

affinity isolated antibody

antibody product type

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

74 kDa

species reactivity

human

concentración

0.5 mg - 1 mg/mL

aplicaciones

western blot: suitable

conjugado

unconjugated

Nº de acceso NCBI

Nº de acceso UniProt

enviado en

wet ice

temp. de almacenamiento

−20°C

Gene Information

human ... CHML(1122)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human CHML

Aplicación

Anti-CHML antibody produced in rabbit is suitable for western blotting at a concentration of 0.05 μg/ml.

Acciones bioquímicas o fisiológicas

CHML (Rab escort protein 2) binds to newly synthesized Rab proteins and mediates geranylgeranylation of most Rab proteins. It may substitute for the absent function of REP1 protein in non-retinal cells and prevent the cellular dysfunction in patients with choroideremia.

Secuencia

Synthetic peptide located within the following region: NPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLEVTD

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Alemania

WGK 3

Punto de inflamabilidad F

Not applicable

Punto de inflamabilidad C

Not applicable

Certificado de Análisis
F P Cremers et al.
The Journal of biological chemistry, 269(3), 2111-2117 (1994-01-21)
Rab escort proteins (REPs) bind to newly synthesized Rab proteins and remain bound during and after the attachment of a geranylgeranyl (GG) group by the catalytic component of the Rab GG transferase. Transfer of the GG group is absolutely dependent...

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico

Redes sociales

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Investigación. Desarrollo. Producción.

Somos un proveedor líder para la industria de Ciencias de la Vida con soluciones y servicios para investigación, desarrollo y producción biotecnológicos, y para desarrollo y producción de tratamientos farmacéuticos

© 2021 Merck KGaA, Darmstadt, Alemania y/o sus filiales. Todos los derechos reservados.

Queda estrictamente prohibida la reproducción sin permiso de cualquiera de los materiales de la página web.