AV31708

Sigma-Aldrich

Anti-ZNF609 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:
Anti-Zinc finger protein 609
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

forma del anticuerpo

IgG fraction of antiserum

antibody product type

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

155 kDa

species reactivity

human, rat

concentración

0.5 mg - 1 mg/mL

aplicaciones

western blot: suitable

conjugado

unconjugated

Nº de acceso NCBI

Nº de acceso UniProt

enviado en

wet ice

temp. de almacenamiento

−20°C

Gene Information

human ... ZNF609(23060)

Descripción general

ZNF609 is a zinc-finger protein that may function as a p53-regulated target.
Rabbit Anti-ZNF609 antibody recognizes chicken, human, bovine, mouse, and rat ZNF609.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ZNF609

Aplicación

Rabbit Anti-ZNF609 antibody can be used for western blot applications at a concentration of 1.25μg/ml.

Acciones bioquímicas o fisiológicas

The function of ZNF609 remains unknown.

Secuencia

Synthetic peptide located within the following region: NIKFVTPVPGPQGKEGKSKSKRSKSGKDTSKPTPGTSLFTPSEGAASKKE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Alemania

WGK 3

Punto de inflamabilidad F

Not applicable

Punto de inflamabilidad C

Not applicable

Certificado de Análisis
Christopher Brynczka et al.
BMC genomics, 8, 139-139 (2007-06-02)
p53 is recognized as a critical regulator of the cell cycle and apoptosis. Mounting evidence also suggests a role for p53 in differentiation of cells including neuronal precursors. We studied the transcriptional role of p53 during nerve growth factor-induced differentiation...

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico

Redes sociales

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Investigación. Desarrollo. Producción.

Somos un proveedor líder para la industria de Ciencias de la Vida con soluciones y servicios para investigación, desarrollo y producción biotecnológicos, y para desarrollo y producción de tratamientos farmacéuticos

© 2021 Merck KGaA, Darmstadt, Alemania y/o sus filiales. Todos los derechos reservados.

Queda estrictamente prohibida la reproducción sin permiso de cualquiera de los materiales de la página web.