AV32876

Sigma-Aldrich

Anti-DKFZP761C169 antibody produced in rabbit

affinity isolated antibody

NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

forma del anticuerpo

affinity isolated antibody

antibody product type

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

52 kDa

species reactivity

human

concentración

0.5 mg - 1 mg/mL

aplicaciones

immunohistochemistry: suitable
western blot: suitable

conjugado

unconjugated

Nº de acceso NCBI

Nº de acceso UniProt

enviado en

wet ice

temp. de almacenamiento

−20°C

Gene Information

human ... DKFZP761C169(65056)

Descripción general

DKFZP761C169 (GPBP,SSH6 or VASCULIN) is a GC-rich promoter binding protein that has been implicated in atherosclerosis. It may also function as a transcription factor.
Rabbit Anti-DKFZP761C169 recognizes human, mouse, rat, bovine, chicken, and canine DKFZP761C169.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human DKFZP761C169

Aplicación

Rabbit Anti-DKFZP761C169 can be used for IHC (4-8μg/ml) and western blot (0.5μg/ml) applications.

Acciones bioquímicas o fisiológicas

Vasculin is a novel vascular protein differentially expressed in human atherogenesis

Secuencia

Synthetic peptide located within the following region: RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Alemania

WGK 3

Punto de inflamabilidad F

Not applicable

Punto de inflamabilidad C

Not applicable

Certificado de Análisis
Ann P J J Bijnens et al.
Blood, 102(8), 2803-2810 (2003-07-05)
Recent suppressive subtractive hybridization analysis on human atherosclerotic plaque-derived RNA revealed genes upregulated in plaques with a thrombus versus stable plaques. Clone SSH6, containing part of a putative open reading frame of an unknown protein, was further investigated. Full-length cDNA...

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico

Redes sociales

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Investigación. Desarrollo. Producción.

Somos un proveedor líder para la industria de Ciencias de la Vida con soluciones y servicios para investigación, desarrollo y producción biotecnológicos, y para desarrollo y producción de tratamientos farmacéuticos

© 2021 Merck KGaA, Darmstadt, Alemania y/o sus filiales. Todos los derechos reservados.

Queda estrictamente prohibida la reproducción sin permiso de cualquiera de los materiales de la página web.