AV34203

Sigma-Aldrich

Anti-ASH2L antibody produced in rabbit

affinity isolated antibody

Sinónimos:
Anti-Bre2, Anti-ASH2L2, Anti-ASH2L1, Anti-Ash2 (absent, small, or homeotic)-like (Drosophila), Anti-ASH2
Número MDL:
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

forma del anticuerpo

affinity isolated antibody

antibody product type

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

69 kDa

species reactivity

human, rat, dog, guinea pig, horse, bovine

concentración

0.5 mg - 1 mg/mL

aplicaciones

western blot: suitable

conjugado

unconjugated

Nº de acceso NCBI

Nº de acceso UniProt

enviado en

wet ice

temp. de almacenamiento

−20°C

Gene Information

human ... ASH2L(9070)

Descripción general

ASH2L is known to differentially modulate the MLL-catalysis of H3K4 trimethylation. It has been implicated in hematopoiesis and leukemia.
Rabbit Anti-ASH2L antibody recognizes canine, zebrafish, human, bovine, mouse, and rat ASH2L.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ASH2L

Aplicación

Rabbit Anti-ASH2L antibody can be used for western blot applications at a concentration of 0.25 μg/ml.

Acciones bioquímicas o fisiológicas

ASH2L plays a role in hematopoiesis and is associated with some special kinds of leukemia. The amount of ASH2L transcripts is extremely high in fetal liver, testis, and leukemia cell lines with erythroid and megakaryocytic potential.

Secuencia

Synthetic peptide located within the following region: EPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVD

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Alemania

WGK 3

Punto de inflamabilidad F

Not applicable

Punto de inflamabilidad C

Not applicable

Certificado de Análisis
Melissa M Steward et al.
Nature structural & molecular biology, 13(9), 852-854 (2006-08-08)
MLL complexes are homologs of yeast COMPASS capable of methylating histone H3 Lys4 (H3K4). ASH2L, RbBP5 and WDR5 are conserved subunits of MLL complexes with homology to the Cps40/Cps60, Cps50 and Cps30 subunits of COMPASS, respectively. We report that ASH2L...
J Wang et al.
Journal of molecular medicine (Berlin, Germany), 79(7), 399-405 (2001-07-24)
Abstract Drosophila ash2 is a member of the trxG gene super family, some human homologues of which are involved in hematopoiesis and leukemia. We report here the identification of the human homologue of Drosophila ash2 and its alternative splicing isoform...

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico

Redes sociales

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Investigación. Desarrollo. Producción.

Somos un proveedor líder para la industria de Ciencias de la Vida con soluciones y servicios para investigación, desarrollo y producción biotecnológicos, y para desarrollo y producción de tratamientos farmacéuticos

© 2021 Merck KGaA, Darmstadt, Alemania y/o sus filiales. Todos los derechos reservados.

Queda estrictamente prohibida la reproducción sin permiso de cualquiera de los materiales de la página web.