AV36579

Sigma-Aldrich

Anti-ANXA3 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:
Anti-Annexin A3
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

forma del anticuerpo

IgG fraction of antiserum

antibody product type

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

36 kDa

species reactivity

guinea pig, human, rat, dog, horse

concentración

0.5 mg - 1 mg/mL

aplicaciones

western blot: suitable

conjugado

unconjugated

Nº de acceso NCBI

Nº de acceso UniProt

enviado en

wet ice

temp. de almacenamiento

−20°C

Gene Information

human ... ANXA3(306)

Inmunógeno

Synthetic peptide directed towards the C terminal region of human ANXA3

Secuencia

Synthetic peptide located within the following region: RIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Alemania

WGK 2

Punto de inflamabilidad F

Not applicable

Punto de inflamabilidad C

Not applicable

Certificado de Análisis
Na Wu et al.
Clinical & translational oncology : official publication of the Federation of Spanish Oncology Societies and of the National Cancer Institute of Mexico, 15(2), 106-110 (2012-09-27)
Annexin family proteins are a well-known multigene family of Ca(2+)-regulated phospholipid- and membrane-binding proteins. As one of the annexin family genes/proteins, accumulated researches have begun to reveal that annexin A3 (Anxa3) exhibits important roles in tumor development, metastasis and drug...
Volker Gerke et al.
Nature reviews. Molecular cell biology, 6(6), 449-461 (2005-06-02)
Eukaryotic cells contain various Ca(2+)-effector proteins that mediate cellular responses to changes in intracellular Ca(2+) levels. A unique class of these proteins - annexins - can bind to certain membrane phospholipids in a Ca(2+)-dependent manner, providing a link between Ca(2+)...
Hiroshi Nishiura et al.
Experimental and molecular pathology, 97(2), 241-246 (2014-07-19)
The roles of annexin A3 (ANXA3) in macrophages are not fully understood. In contrast to C5a, we have demonstrated that C-terminal ribosomal protein S19 (RP S19)-tagged S-tagged C5a (S-tagged C5a/RP S19) raises an alternative cytoplasmic calcium oscillation by extracellular calcium...
Wen-Yong Wu et al.
Medical oncology (Northwood, London, England), 31(8), 108-108 (2014-07-10)
Autophagy is a cellular recycling process to enable cell survival in less favorable conditions through degradation of their unnecessary cellular components and utilization of the breakdown components. Autophagy also plays an important role in tumor pathology. In this study, we...
Tangli Xiao et al.
Molecular and cellular biochemistry, 394(1-2), 145-154 (2014-05-23)
The aim was to explore the effects of rapamycin on autophagy and injury of podocytes in streptozocin (STZ)-induced type 1 diabetic mice, and its role in delaying progression of diabetic nephropathy. In this study, male Balb/c mice were divided into...

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico

Redes sociales

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Investigación. Desarrollo. Producción.

Somos un proveedor líder para la industria de Ciencias de la Vida con soluciones y servicios para investigación, desarrollo y producción biotecnológicos, y para desarrollo y producción de tratamientos farmacéuticos

© 2021 Merck KGaA, Darmstadt, Alemania y/o sus filiales. Todos los derechos reservados.

Queda estrictamente prohibida la reproducción sin permiso de cualquiera de los materiales de la página web.