AV37028

Sigma-Aldrich

Anti-NR1I3 (AB1) antibody produced in rabbit

IgG fraction of antiserum

origen biológico

rabbit

forma del anticuerpo

IgG fraction of antiserum

antibody product type

primary antibodies

clon

polyclonal

formulario

lyophilized powder

mol peso

39 kDa

species reactivity

mouse

concentración

0.5 mg - 1 mg/mL

aplicaciones

immunohistochemistry: suitable
western blot: suitable

conjugado

unconjugated

Nº de acceso NCBI

Nº de acceso UniProt

temp. de almacenamiento

−20°C

Gene Information

mouse ... NR1I3(12355)

Inmunógeno

The immunogen for anti-NR1I3 antibody: synthetic peptide derected towards the C terminal of human NR1I3

Aplicación

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Secuencia

Synthetic peptide located within the following region: QQSRLQSRFLYAKLMGLLADLRSINNAYSYELQRLEELSAMTPLLGEICS

Forma física

Lyophilized from PBS buffer with 2% sucrose

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Alemania

WGK 2

Punto de inflamabilidad F

Not applicable

Punto de inflamabilidad C

Not applicable

Certificado de Análisis
H Fukumasu et al.
Brazilian journal of medical and biological research = Revista brasileira de pesquisas medicas e biologicas, 48(3), 240-244 (2015-02-26)
Nuclear receptor subfamily 1, group I, member 3 (NR1I3) is reported to be a possible novel therapeutic target for some cancers, including lung, brain and hematopoietic tumors. Here, we characterized expression of NR1I3 in a mouse model of lung carcinogenesis...

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico

Redes sociales

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Investigación. Desarrollo. Producción.

Somos un proveedor líder para la industria de Ciencias de la Vida con soluciones y servicios para investigación, desarrollo y producción biotecnológicos, y para desarrollo y producción de tratamientos farmacéuticos

© 2021 Merck KGaA, Darmstadt, Alemania y/o sus filiales. Todos los derechos reservados.

Queda estrictamente prohibida la reproducción sin permiso de cualquiera de los materiales de la página web.