AV37058

Sigma-Aldrich

Anti-HMG20B antibody produced in rabbit

affinity isolated antibody

NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

forma del anticuerpo

affinity isolated antibody

antibody product type

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

35 kDa

species reactivity

rat, human, mouse

concentración

0.5 mg - 1 mg/mL

aplicaciones

western blot: suitable

conjugado

unconjugated

Nº de acceso NCBI

Nº de acceso UniProt

enviado en

wet ice

temp. de almacenamiento

−20°C

Gene Information

mouse ... HMG20B(15353)

Inmunógeno

Synthetic peptide directed towards the N terminal of human HMG20B

Acciones bioquímicas o fisiológicas

Hmg20b is the component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, AOF2/LSD1, RCOR1/CoREST and PHF21A/BHC80. Hmg20b is required for correct progression through G2 phase of the cell cycle and entry into mitosis Hmg20b is also required for RCOR1/CoREST mediated repression of neuronal specific gene promoters.

Secuencia

Synthetic peptide located within the following region: MSHGPRQPGAATAPAGGKTPGQHGAFVVAVKQERSEGSRAGEKGPQEEEP

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Alemania

WGK 2

Punto de inflamabilidad F

Not applicable

Punto de inflamabilidad C

Not applicable

Certificado de Análisis

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico

Redes sociales

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Investigación. Desarrollo. Producción.

Somos un proveedor líder para la industria de Ciencias de la Vida con soluciones y servicios para investigación, desarrollo y producción biotecnológicos, y para desarrollo y producción de tratamientos farmacéuticos

© 2021 Merck KGaA, Darmstadt, Alemania y/o sus filiales. Todos los derechos reservados.

Queda estrictamente prohibida la reproducción sin permiso de cualquiera de los materiales de la página web.