AV43805

Anti-SLC12A2 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-BSC, Anti-BSC2, Anti-MGC104233, Anti-NKCC1, Anti-Solute carrier family 12 (sodium/potassium/chloride transporters), member 2
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 1

Propiedades

• biological source: rabbit
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 131 kDa
• species reactivity: rat, dog, rabbit, bovine, pig, horse, human, mouse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_001037
• UniProt accession no.: P55011
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Quality Level: 100
• Gene Information: human ... SLC12A2(6558)

Descripción

Immunogen

Synthetic peptide directed towards the C terminal region of human SLC12A2

Biochem/physiol Actions

SLC12A2 is sodium and chloride ion transporter that is activated in response to DNA damage. It regulates ionic balance in the cell and maintains the cell volume.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Clase de almacenamiento: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable