HPA029974

Sigma-Aldrich

Anti-FOXM1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:
Anti-MPP2, Anti-TGT3, Anti-HFH-11, Anti-INS-1, Anti-MPHOSPH2, Anti-FKHL16, Anti-Forkhead box M1, Anti-HNF-3, Anti-Trident
Atlas de proteínas humanas número:

origen biológico

rabbit

Nivel de calidad

100

forma del anticuerpo

affinity isolated antibody

antibody product type

primary antibodies

clon

polyclonal

línea de producto

Prestige Antibodies® Powered by Atlas Antibodies

formulario

buffered aqueous glycerol solution

species reactivity

human

envase

antibody small pack of 25 μL

validación mejorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

aplicaciones

immunohistochemistry: 1:200- 1:500

secuencia del inmunógeno

GIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGL

conjugado

unconjugated

Industria destacada

Research Pathology

Nº de acceso UniProt

enviado en

wet ice

temp. de almacenamiento

−20°C

Gene Information

human ... FOXM1(2305)

Inmunógeno

forkhead box M1 recombinant protein epitope signature tag (PrEST)

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST78473.

Forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

storage_class_code

12 - Non Combustible Liquids

WGK Alemania

WGK 1

Punto de inflamabilidad F

Not applicable

Punto de inflamabilidad C

Not applicable

Certificado de Análisis

Certificado de origen

FOXM1 regulates glycolysis in hepatocellular carcinoma by transactivating glucose transporter 1 expression.
Shang R
Oncology Reports, 37(4), 2261-2269 (2017)
Overexpressed transcription factor FOXM1 contributes to the progression of colorectal cancer.
Zhang H
Molecular Medicine Reports, 13(3), 2696-2700 (2016)
Targeted inhibition of metastatic melanoma through interference with Pin1-FOXM1 signaling.
Kruiswijk F
Oncogene, 35(17), 2166-2177 (2016)
Genetic determinants of FOXM1 overexpression in epithelial ovarian cancer and functional contribution to cell cycle progression.
Barger CJ
Oncotarget, 6(29), 27613-27627 (2015)
Quantitative proteomic analysis identifies new effectors of FOXM1 involved in breast cancer cell migration.
Ye X
International Journal of Clinical and Experimental Pathology, 8(12), 15836-15844 (2015)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico