SAB1402250

Monoclonal Anti-LAMP2 antibody produced in mouse

clone 2G10, purified immunoglobulin, buffered aqueous solution

• Sinónimos: CD107b, LAMPB, LGP110
• Número MDL: MFCD01864919
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 2G10, monoclonal
• formulario: buffered aqueous solution
• mol peso: antigen ~36.89 kDa
• reactividad de especies: human
• técnicas: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_013995
• Nº de acceso UniProt: P13473
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... LAMP2(3920)

Descripción

Descripción general

The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins. (provided by RefSeq) Lysosome-associated membrane protein 2 (LAMP2) is expressed in the lysosomal lumen and membrane. In the tumor microenvironment, it is found to be present in the plasma membrane. The gene encoding this protein is localized on human chromosome Xq24.

Inmunógeno

LAMP2 (NP_054701, 30 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFP

Aplicación

Monoclonal Anti-LAMP2 antibody produced in mouse has been used in immunofluorescence.

Acciones bioquímicas o fisiológicas

Lysosome-associated membrane protein 2 (LAMP2) protects lysosomal membranes from acid proteolysis. It serves as an acidity biomarker in spheroids and xenografts.The protein also has a role in maturation of autophagic vacuoles and cell-cell or cell-extracellular matrix adhesion. Mutation in the LAMP2 gene has been linked to cardiomyopathy in young patients.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable