Merck
All Photos(1)

SAB1407827

Sigma-Aldrich

Anti-IL21 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Synonym(s):
Za11, IL-21
NACRES:
NA.41

Nivel de calidad

100

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

antibody product type

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

antigen ~18.7 kDa

species reactivity

human

technique(s)

western blot: 1 μg/mL

Nº de acceso NCBI

Nº de acceso UniProt

enviado en

dry ice

temp. de almacenamiento

−20°C

Gene Information

human ... IL21(59067)

Inmunógeno

IL21 (NP_068575, 1 a.a. ~ 162 a.a) full-length human protein.

Sequence
MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS

Forma física

Solution in phosphate buffered saline, pH 7.4

Código de clase de almacenamiento

13 - Non Combustible Solids

WGK

WGK 1

Punto de inflamabilidad F

Not applicable

Punto de inflamabilidad C

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service