Merck
All Photos(1)

SAB1410873

Sigma-Aldrich

Anti-IL22 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Synonym(s):
MGC79384, IL-22, IL-TIF, IL21, IL-21, IL-D110, ILTIF, TIFIL-23, MGC79382
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

antibody product type

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

antigen 20 kDa

species reactivity

human

technique(s)

western blot: 1 μg/mL

Nº de acceso NCBI

Nº de acceso UniProt

enviado en

dry ice

temp. de almacenamiento

−20°C

Gene Information

human ... IL22(50616)

Inmunógeno

IL22 (NP_065386.1, 1 a.a. ~ 179 a.a) full-length human protein.

Sequence
MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Forma física

Solution in phosphate buffered saline, pH 7.4

Código de clase de almacenamiento

12 - Non Combustible Liquids

WGK

WGK 3

Punto de inflamabilidad F

Not applicable

Punto de inflamabilidad C

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service