Search Within
Product Category
Brand
Biological Source
Color
Feature
Formula Weight
Gene Alias
Physical Form
Purity
Chemical Composition
Quality Segment
Technique
Available for Sale
h-gly-arg-gly-asp-ser
Applied Filters:
Keyword:'h-gly-arg-gly-asp-ser'
Showing 1-30 of 141 results for "h-gly-arg-gly-asp-ser" within Products
All Photos(2)
H-Gly-Arg-Gly-Asp-Ser-Pro-OH
Synonym(s): H-Gly-Arg-Gly-Asp-Ser-Pro-OH
Empirical Formula (Hill Notation): C22H37N9O10
- Molecular Weight:
- 587.58
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| 03-34-0035 | Shown to inhibit fibronectin binding to platelet-binding sites. | |||||||
All Photos(1)
H-Gly-Arg-Ala-Asp-Ser-Pro-OH
Synonym(s): H-Gly-Arg-Ala-Asp-Ser-Pro-OH
Empirical Formula (Hill Notation): C23H39N9O10
- Molecular Weight:
- 601.61
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| 03-34-0052 | Inactive control peptide for other fibronectin inhibitors. | |||||||
All Photos(1)
Ser-Asp-Gly-Arg-Gly
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| S3771 | ≥90% (HPLC) | |||||||
All Photos(1)
H-Arg-Gly-Asp-Ser-OH
Synonym(s): H-Arg-Gly-Asp-Ser-OH
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| 03-34-0002 | ||||||||
All Photos(1)
Gly-Arg-Gly-Asp-Ser
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| G4391 | ≥97% (HPLC) | |||||||
All Photos(1)
Arg-Gly-Asp-Ser
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| A9041 | ≥95% (HPLC) | |||||||
All Photos(1)
Gly-Arg-Gly-Asp-Ser-Pro-Lys
Synonym(s): GRGDSPK
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| G1269 | ≥97% (HPLC) | |||||||
All Photos(1)
Gly-Arg-Gly-Asp-Ser-Pro (GRGDSP)
Empirical Formula (Hill Notation): C22H37N9O10
- Molecular Weight:
- 587.58
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| SCP0157 | ||||||||
All Photos(1)
Arg-Gly-Asp-Ser-Pro-Ala-Ser-Ser-Lys-Pro
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| A6677 | synthetic (organicorganic), ≥97% (HPLC), fibronectin binding inhibitor, powder | |||||||
All Photos(1)
Gly-Arg-Ala-Asp-Ser-Pro (GRADSP)
Empirical Formula (Hill Notation): C23H39N9O10
- Molecular Weight:
- 601.61
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| SCP0156 | ||||||||
All Photos(1)
Arg-Gly-Asp-Ser acetate
- Molecular Weight:
- 493.47
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| TA9H97F31182 | ||||||||
All Photos(1)
Gly-Arg-Gly-Asp-Ser TFA
- CAS No.:
- 2828433-23-2
- Molecular Weight:
- 604.5
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| BL3H9998EEE4 | ||||||||
All Photos(1)
H-Gly-Arg-Gly-Asp-Asn-Pro-OH
- CAS No.:
- 114681-65-1
- Molecular Weight:
- 614.62
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| TA9H93ED6C41 | ||||||||
All Photos(1)
Gly-Arg-Gly-Asp-Ser acetate(96426-21-0 free base)
- Molecular Weight:
- 550.53
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| TA9H97BAF1CE | ||||||||
All Photos(1)
H-Arg-Pro-PRO-Gly-Phe-Ser-Pro-OH trifluoroacetate
- CAS No.:
- 2828433-15-2
- Molecular Weight:
- 870.88
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| BL3H99F8D230 | ||||||||
All Photos(1)
Orcokinin
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| O2011 | ≥90% (HPLC) | |||||||
All Photos(1)
Tyr-C-Peptide human
Synonym(s): Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg, Tyr-Insulin C chain
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| C9781 | ≥95% (HPLC) | |||||||
All Photos(1)
L-BNP trifluoroacetate salt
Synonym(s): Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Leu-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His [Disulfide Bridge: 10-26] trifluoroacetate salt, [Leu13]-BNP trifluoroacetate salt, [Leu13]-Brain Natriuretic Peptide-32 trifluoroacetate salt
Empirical Formula (Hill Notation): C143H243N47O42S4 · xC2HF3O2
- Molecular Weight:
- 3421.01 (free base basis)
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| B7313 | ≥98% (HPLC) | |||||||
All Photos(1)
Copeptin trifluoroacetate human
Synonym(s): H-Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr-OH trifluoroacetate
Empirical Formula (Hill Notation): C177H279N49O58 · xC2HF3O2
- CAS No.:
- 78362-34-2
- Molecular Weight:
- 4021.40 (free base basis)
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| C8749 | ≥95% (HPLC) | |||||||
All Photos(1)
Liraglutide
Synonym(s): Arg34, Lys26-[Nε(γ-Glu[Nα-hexadecanoyl])]-GLP-1[7-37], H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-N6-[N-(1-oxohexadecyl)-L-γ-glutamyl]-Lys-α-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly-OH, HAEGTFTSDVSSYLEGQAA-N6-[N-(1-oxohexadecyl)-L-γ-glutamyl]K-EFIAWLVRGRG, NN2211
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| SML3925 | ≥95% (HPLC), GLP-1 receptor agonist, Powder or Lyophilized powder or film | |||||||
All Photos(1)
Nrf2 Activator III, TAT-14 Peptide
Synonym(s): Nrf2 Activator III, TAT-14 Peptide
All Photos(1)
740 Y-P trifluoroacetate
Synonym(s): 740 YP trifluoroacetate, 740-YP trifluoroacetate, 740Y-P trifluoroacetate, 740YP trifluoroacetate, 740YPDGFR trifluoroacetate, PDGFR 740Y-P trifluoroacetate, RQIKIWFQNRRMKWKK-SDGGY(P)MDMS trifluoroacetate, RQIKIWFQNRRMKWKK-SDGGpYMDMS trifluoroacetate, Arg-Gln-Ile-Lys-Ile-Try-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Asp-Gly-Gly-Tyr(P)-Met-Asp-Met-Ser trifluoroacetate
Empirical Formula (Hill Notation): C141H222N43O39PS3 · xC2HF3O2
- CAS No.:
- 1236188-16-1
- Molecular Weight:
- 3270.70 (free base basis)
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| SML4269 | ≥95% (HPLC) | ![]() | ||||||
All Photos(1)
Lixisenatide
Synonym(s): (Des-Pro38)-Exendin-4-(Lys)6 amide, AVE0010, HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2, His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2, ZP10, ZP10A
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| SML2836 | ≥95% (HPLC), Exendin-4-derived glucagon-like peptide-1 receptor (GLP-1R) agonist , lyophilized powder | |||||||
All Photos(1)
Peptide YY porcine
Synonym(s): PYY, Tyr-Pro-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| P5801 | ≥97% (HPLC), synthetic | |||||||
All Photos(1)
Peptide YY human
Synonym(s): PYY, Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| P1306 | ≥97% (HPLC), synthetic | |||||||
All Photos(1)
Hepcidin-25 (human) trifluoroacetate salt
Synonym(s): DTHFPICIFCCGCCHRSKCGMCCKT trifluoroacetate salt, H-Asp-Thr-His-Phe-Pro-Ile-Cys-Ile-Phe-Cys-Cys-Gly-Cys-Cys-His-Arg-Ser-Lys-Cys-Gly-Met-Cys-Cys-Lys-Thr-OH trifluoroacetate salt, Hepc25 (human), LEAP-1 (Liver-Expressed Antimicrobial Peptide) (human) trifluoroacetate salt, PLTR (Putative Liver Tumor Regressor ) (human)
Empirical Formula (Hill Notation): C113H170N34O31S9 · xC2HF3O2
- CAS No.:
- 342809-17-0
- Molecular Weight:
- 2789.35 (free base basis)
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| SML1118 | ≥95% (HPLC), iron homeostasis regulator, powder | |||||||
All Photos(1)
CIGB-300 trifluoroacetate
Synonym(s): CIGB-325 trifluoroacetate, H-GRKKRRQRRRPPQ-βA-CWMSPRHLGTC-NH2 trifluoroacetate (βA = β-alanine; C15-C25 disulfide), H-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Pro-Pro-Gln-βAla-Cys-Trp-Met-Ser-Pro-Arg-His-Leu-Gly-Thr-Cys-NH2 trifluoroacetate (Cys15-Cys25 disulfide), P15-Tat trifluoroacetate
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| SML3143 | ≥95% (HPLC) | |||||||
All Photos(1)
Hypercalcemia of malignancy factor fragment 1-34 amide human
Synonym(s): Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-NH2, PTHrP (1-34) amide, Parathyroid hormone-related protein (1-34) Amide
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| H9148 | ≥97% (HPLC) | |||||||
All Photos(1)
Hypercalcemia of malignancy factor 1-40 human
Synonym(s): Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile-Arg-Ala-Thr-Ser, PTH-Like Adenylate Cyclase Stimulating Protein, PTHrP (1-40), Parathyroid hormone-related protein (1-40)
| Compare | Product No. | Description | Pricing | |||||
|---|---|---|---|---|---|---|---|---|
| H4644 | ≥95% (HPLC), suitable fo drug transporter assays | |||||||
All Photos(1)
FR-1, cyclic
Empirical Formula (Hill Notation): C35H57N13O16S2
- Molecular Weight:
- 980.03
| Compare | Product No. | Description | SDS | Pricing | ||||
|---|---|---|---|---|---|---|---|---|
| SCP0147 | ||||||||
Page 1 of 5
