h-gly-arg-gly-asp-ser

Applied Filters:

Keyword:'h-gly-arg-gly-asp-ser'

Showing 1-30 of 143 results for "h-gly-arg-gly-asp-ser" within Products

All Photos(2)

H-Gly-Arg-Gly-Asp-Ser-Pro-OH

Synonym(s): H-Gly-Arg-Gly-Asp-Ser-Pro-OH

Empirical Formula (Hill Notation): C₂₂H₃₇N₉O₁₀

Molecular Weight:: 587.58

Compare	Product No.	Description					SDS	Pricing
	03-34-0035	Shown to inhibit fibronectin binding to platelet-binding sites.

All Photos(1)

H-Gly-Arg-Ala-Asp-Ser-Pro-OH

Synonym(s): H-Gly-Arg-Ala-Asp-Ser-Pro-OH

Empirical Formula (Hill Notation): C₂₃H₃₉N₉O₁₀

Molecular Weight:: 601.61

Compare	Product No.	Description					SDS	Pricing
	03-34-0052	Inactive control peptide for other fibronectin inhibitors.

All Photos(1)

Ser-Asp-Gly-Arg-Gly

Empirical Formula (Hill Notation): C₁₇H₃₀N₈O₉

CAS No.:: 108608-63-5
Molecular Weight:: 490.47

Compare	Product No.	Description					SDS	Pricing
	S3771	≥90% (HPLC)

All Photos(1)

H-Arg-Gly-Asp-Ser-OH

Synonym(s): H-Arg-Gly-Asp-Ser-OH

Empirical Formula (Hill Notation): C₁₅H₂₇N₇O₈

CAS No.:: 91037-65-9
Molecular Weight:: 433.42

Compare	Product No.	Description					SDS	Pricing
	03-34-0002

All Photos(1)

Gly-Arg-Gly-Asp-Ser

Empirical Formula (Hill Notation): C₁₇H₃₀N₈O₉

CAS No.:: 96426-21-0
Molecular Weight:: 490.47

Compare	Product No.	Description					SDS	Pricing
	G4391	≥97% (HPLC)

All Photos(1)

Arg-Gly-Asp-Ser

Empirical Formula (Hill Notation): C₁₅H₂₇N₇O₈

CAS No.:: 91037-65-9
Molecular Weight:: 433.42

Compare	Product No.	Description					SDS	Pricing
	A9041	≥95% (HPLC)

All Photos(1)

Gly-Arg-Gly-Asp-Ser-Pro-Lys

Synonym(s): GRGDSPK

Empirical Formula (Hill Notation): C₂₈H₄₉N₁₁O₁₁

CAS No.:: 111119-28-9
Molecular Weight:: 715.76

Compare	Product No.	Description					SDS	Pricing
	G1269	≥97% (HPLC)

All Photos(1)

Gly-Arg-Gly-Asp-Ser-Pro (GRGDSP)

Empirical Formula (Hill Notation): C₂₂H₃₇N₉O₁₀

Molecular Weight:: 587.58

Compare	Product No.	Description					SDS	Pricing
	SCP0157

All Photos(1)

Arg-Gly-Asp-Ser-Pro-Ala-Ser-Ser-Lys-Pro

Empirical Formula (Hill Notation): C₄₀H₆₈N₁₄O₁₆

CAS No.:: 91575-25-6
Molecular Weight:: 1001.05

Compare	Product No.	Description					SDS	Pricing
	A6677	synthetic (organicorganic), ≥97% (HPLC), fibronectin binding inhibitor, powder

All Photos(1)

Gly-Arg-Ala-Asp-Ser-Pro (GRADSP)

Empirical Formula (Hill Notation): C₂₃H₃₉N₉O₁₀

Molecular Weight:: 601.61

Compare	Product No.	Description					SDS	Pricing
	SCP0156

All Photos(1)

Arg-Gly-Asp-Ser

CAS No.:: 91037-65-9
Molecular Weight:: 433.42

Compare	Product No.	Description						Pricing
	BL3H1F1CB2EF

All Photos(1)

Arg-Gly-Asp-Ser acetate

Molecular Weight:: 493.47

Compare	Product No.	Description						Pricing
	TA9H97F31182

All Photos(1)

Gly-Arg-Gly-Asp-Ser TFA

CAS No.:: 2828433-23-2
Molecular Weight:: 604.5

Compare	Product No.	Description						Pricing
	BL3H9998EEE4

All Photos(1)

H-Gly-Arg-Gly-Asp-Asn-Pro-OH

CAS No.:: 114681-65-1
Molecular Weight:: 614.62

Compare	Product No.	Description						Pricing
	TA9H93ED6C41

All Photos(1)

Gly-Arg-Gly-Asp-Ser acetate(96426-21-0 free base)

Molecular Weight:: 550.53

Compare	Product No.	Description						Pricing
	TA9H97BAF1CE

All Photos(1)

H-Arg-Pro-PRO-Gly-Phe-Ser-Pro-OH trifluoroacetate

CAS No.:: 2828433-15-2
Molecular Weight:: 870.88

Compare	Product No.	Description						Pricing
	BL3H99F8D230

All Photos(1)

Orcokinin

Compare	Product No.	Description						Pricing
	O2011	≥90% (HPLC)

All Photos(1)

Tyr-C-Peptide human

Synonym(s): Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg, Tyr-Insulin C chain

Empirical Formula (Hill Notation): C₁₆₂H₂₆₈N₅₀O₅₄

CAS No.:: 139532-11-9
Molecular Weight:: 3780.16

Compare	Product No.	Description					SDS	Pricing
	C9781	≥95% (HPLC)

All Photos(1)

L-BNP trifluoroacetate salt

Synonym(s): Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Leu-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His [Disulfide Bridge: 10-26] trifluoroacetate salt, [Leu13]-BNP trifluoroacetate salt, [Leu13]-Brain Natriuretic Peptide-32 trifluoroacetate salt

Empirical Formula (Hill Notation): C₁₄₃H₂₄₃N₄₇O₄₂S₄ · xC₂HF₃O₂

Molecular Weight:: 3421.01 (free base basis)

Compare	Product No.	Description					SDS	Pricing
	B7313	≥98% (HPLC)

All Photos(1)

Copeptin trifluoroacetate human

Synonym(s): H-Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr-OH trifluoroacetate

Empirical Formula (Hill Notation): C₁₇₇H₂₇₉N₄₉O₅₈ · xC₂HF₃O₂

CAS No.:: 78362-34-2
Molecular Weight:: 4021.40 (free base basis)

Compare	Product No.	Description					SDS	Pricing
	C8749	≥95% (HPLC)

All Photos(1)

Liraglutide

Synonym(s): Arg34, Lys26-[Nε(γ-Glu[Nα-hexadecanoyl])]-GLP-1[7-37], H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-N6-[N-(1-oxohexadecyl)-L-γ-glutamyl]-Lys-α-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly-OH, HAEGTFTSDVSSYLEGQAA-N6-[N-(1-oxohexadecyl)-L-γ-glutamyl]K-EFIAWLVRGRG, NN2211

Empirical Formula (Hill Notation): C₁₇₂H₂₆₅N₄₃O₅₁

CAS No.:: 204656-20-2
Molecular Weight:: 3751.20

Compare	Product No.	Description					SDS	Pricing
	SML3925	≥95% (HPLC), GLP-1 receptor agonist, Powder or Lyophilized powder or film

All Photos(1)

Nrf2 Activator III, TAT-14 Peptide

Synonym(s): Nrf2 Activator III, TAT-14 Peptide

Empirical Formula (Hill Notation): C₁₃₇H₂₃₀N₄₈O₃₉

CAS No.:: 1362661-34-4
Molecular Weight:: 3173.59

Compare	Product No.	Description					SDS	Pricing
	492042	The Nrf2 Activator III, TAT-14 Peptide modulates the biological activity of Nrf2. This small molecule/inhibitor is primarily used for Biochemicals applications.

All Photos(1)

Peptide YY porcine

Synonym(s): PYY, Tyr-Pro-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH₂

Empirical Formula (Hill Notation): C₁₉₀H₂₈₈N₅₄O₅₇

CAS No.:: 81858-94-8
Molecular Weight:: 4240.65

Compare	Product No.	Description						Pricing
	P5801	≥97% (HPLC), synthetic

All Photos(1)

Lixisenatide

Synonym(s): (Des-Pro38)-Exendin-4-(Lys)6 amide, AVE0010, HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2, His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2, ZP10, ZP10A

Empirical Formula (Hill Notation): C₂₁₅H₃₄₇N₆₁O₆₅S

CAS No.:: 320367-13-3
Molecular Weight:: 4858.49

Compare	Product No.	Description					SDS	Pricing
	SML2836	≥95% (HPLC), Exendin-4-derived glucagon-like peptide-1 receptor (GLP-1R) agonist , lyophilized powder

All Photos(1)

Peptide YY human

Synonym(s): PYY, Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH₂

Empirical Formula (Hill Notation): C₁₉₄H₂₉₅N₅₅O₅₇

CAS No.:: 118997-30-1
Molecular Weight:: 4309.75

Compare	Product No.	Description					SDS	Pricing
	P1306	≥97% (HPLC), synthetic

All Photos(1)

CIGB-300 trifluoroacetate

Synonym(s): CIGB-325 trifluoroacetate, H-GRKKRRQRRRPPQ-βA-CWMSPRHLGTC-NH2 trifluoroacetate (βA = β-alanine; C15-C25 disulfide), H-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Pro-Pro-Gln-βAla-Cys-Trp-Met-Ser-Pro-Arg-His-Leu-Gly-Thr-Cys-NH2 trifluoroacetate (Cys15-Cys25 disulfide), P15-Tat trifluoroacetate

Empirical Formula (Hill Notation): C₁₂₇H₂₁₆N₅₄O₂₉S₃

CAS No.:: 2306481-24-1
Molecular Weight:: 3059.61

Compare	Product No.	Description					SDS	Pricing
	SML3143	≥95% (HPLC)

All Photos(1)

Hepcidin-25 (human) trifluoroacetate salt

Synonym(s): DTHFPICIFCCGCCHRSKCGMCCKT trifluoroacetate salt, H-Asp-Thr-His-Phe-Pro-Ile-Cys-Ile-Phe-Cys-Cys-Gly-Cys-Cys-His-Arg-Ser-Lys-Cys-Gly-Met-Cys-Cys-Lys-Thr-OH trifluoroacetate salt, Hepc25 (human), LEAP-1 (Liver-Expressed Antimicrobial Peptide) (human) trifluoroacetate salt, PLTR (Putative Liver Tumor Regressor ) (human)

Empirical Formula (Hill Notation): C₁₁₃H₁₇₀N₃₄O₃₁S₉ · xC₂HF₃O₂

CAS No.:: 342809-17-0
Molecular Weight:: 2789.35 (free base basis)

Compare	Product No.	Description						Pricing
	SML1118	≥95% (HPLC), iron homeostasis regulator, powder

All Photos(1)

Hypercalcemia of malignancy factor fragment 1-34 amide human

Synonym(s): Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-NH₂, PTHrP (1-34) amide, Parathyroid hormone-related protein (1-34) Amide

Empirical Formula (Hill Notation): C₁₈₀H₂₈₈N₅₈O₄₇

CAS No.:: 112955-31-4
Molecular Weight:: 4016.57

Compare	Product No.	Description					SDS	Pricing
	H9148	≥97% (HPLC)

All Photos(1)

Hypercalcemia of malignancy factor 1-40 human

Synonym(s): Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile-Arg-Ala-Thr-Ser, PTH-Like Adenylate Cyclase Stimulating Protein, PTHrP (1-40), Parathyroid hormone-related protein (1-40)

Empirical Formula (Hill Notation): C₂₀₇H₃₃₄N₆₆O₅₈

CAS No.:: 120298-73-9
Molecular Weight:: 4675.27

Compare	Product No.	Description						Pricing
	H4644	≥95% (HPLC), suitable fo drug transporter assays

All Photos(1)

740 Y-P trifluoroacetate

Synonym(s): 740 YP trifluoroacetate, 740-YP trifluoroacetate, 740Y-P trifluoroacetate, 740YP trifluoroacetate, 740YPDGFR trifluoroacetate, PDGFR 740Y-P trifluoroacetate, RQIKIWFQNRRMKWKK-SDGGY(P)MDMS trifluoroacetate, RQIKIWFQNRRMKWKK-SDGGpYMDMS trifluoroacetate, Arg-Gln-Ile-Lys-Ile-Try-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Asp-Gly-Gly-Tyr(P)-Met-Asp-Met-Ser trifluoroacetate

Empirical Formula (Hill Notation): C₁₄₁H₂₂₂N₄₃O₃₉PS₃ · xC₂HF₃O₂

CAS No.:: 1236188-16-1
Molecular Weight:: 3270.70 (free base basis)

Compare	Product No.	Description					SDS	Pricing
	SML4269	≥95% (HPLC)

Page 1 of 5