Merck
All Photos(5)

HPA012657

Sigma-Aldrich

Anti-PLA2R1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
CLEC13C, PLA2-R, PLA2G1R, PLA2IR
Numéro HPA (Human Protein Atlas):

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

antibody product type

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

species reactivity

human

Conditionnement

antibody small pack of 25 μL

Validation améliorée

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:500-1:1000
western blot: 0.04-0.4 μg/mL

N° d'accession UniProt

Expédié(e)(s) dans

wet ice

Temp. de stockage

−20°C

Gene Information

human ... PLA2R1(22925)

Description générale

Phospholipase A2 receptor 1 (PLA2R1) is a type I transmembrane glycoprotein, which is a member of mannose receptor family. It consists of NH2-terminal cysteine-rich domain, a fibronectin-like type II (FNII) domain, a tandem repeat of 8 C-type lectin-like domains (CTLD) and a short intracellular COOH-terminal region. PLA2R1 is localized in the podocytes of kidney. The gene is located on human chromosome 2q24.

Immunogène

Phospholipase a2 receptor 1, 180kda recombinant protein epitope signature tag (PrEST)

Sequence
EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID

Application

Anti-PLA2R1 antibody produced in rabbit has been used in immunohistochemistry and indirect immunofluorescence.

Actions biochimiques/physiologiques

Phospholipase A2 receptor 1 (PLA2R1) is implicated in primary membranous nephropathy (PMN).

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST72110.

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Code de la classe de stockage

10 - Combustible liquids

WGK

WGK 1

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service