Merck
All Photos(8)

HPA023881

Sigma-Aldrich

Anti-TFE3 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Tfe3 Antibody, Tfe3 Antibody - Anti-TFE3 antibody produced in rabbit, TFEA, bHLHe33
Numéro MDL:
Numéro HPA (Human Protein Atlas):

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

antibody product type

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

species reactivity

human, rat, mouse

Conditionnement

antibody small pack of 25 μL

Validation améliorée

RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
western blot: 0.04-0.4 μg/mL

N° d'accession UniProt

application(s)

research pathology

Expédié(e)(s) dans

wet ice

Temp. de stockage

−20°C

Gene Information

human ... TFE3(7030)

Description générale

Transcription factor binding to IGHM enhancer 3 or transcription factor E3 (TFE3) gene is mapped to human chromosome Xp11.23. TFE3 belongs to helix-loop-helix leucine zipper family of transcription factors.

Immunogène

Transcription factor binding to ighm enhancer 3 recombinant protein epitope signature tag (PrEST).

Sequence
SKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAAS

Application

Anti-TFE3(Transcription factor binding to IGHM enhancer 3) antibody produced in rabbit has been used:
  • in immunofluorescence
  • in immunocytochemistry studies
  • in immunostaining

Actions biochimiques/physiologiques

Transcription factor binding to IGHM enhancer 3 (TFE3) interacts with other transcription factors and plays a key role in cell growth and proliferation. It promotes renal adenocarcinoma progression. TFE3 gene locus is also involved in translocations events resulting in a TFE3 fusion protein, which is a potential marker for screening their prevalence in renal cell carcinomas. It interacts and regulates expression of G-protein Gα16 and favors regulation of claudin 14.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST74277.

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Code de la classe de stockage

10 - Combustible liquids

WGK

WGK 1

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service