228-288-5

Applied Filters:

Keyword:'228-288-5'

Showing 1-10 of 10 results for "228-288-5" within Products

All Photos(4)

Potassium 4-nitrophenyl sulfate

Synonym(s): 4-Nitrophenyl sulfate potassium salt

Linear Formula: NO₂C₆H₄OSO₂OK

CAS No.:: 6217-68-1
Molecular Weight:: 257.26
EC No.:: 228-288-5
Beilstein No.:: 3786392

Compare	Product No.	Description	SDS	Pricing
	N3877	sulfatase substrate

Match Criteria:Numéro EC

All Photos(1)

Parathyroid Hormone 1-34, Human

Synonym(s): Parathyroid Hormone 1-34, Human

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description	SDS	Pricing
	05-23-5501	N-terminal active peptide fragment of the native hormone that functions as a regulatory factor in the homeostatic control of Ca²⁺ and phosphate metabolism.

Match Criteria:Mot-clé

All Photos(1)

Neuropeptide Y human

Synonym(s): Neuropeptide Y, Human, NPY, hNPY

Empirical Formula (Hill Notation): C₁₈₉H₂₈₅N₅₅O₅₇S

CAS No.:: 90880-35-6
Molecular Weight:: 4271.68

Compare	Product No.	Description	SDS	Pricing
	05-23-2005	A potent vasoconstrictor.
	N5017	≥95% (HPLC), powder, synthetic

Match Criteria:Mot-clé

All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli

CAS No.:: 129203-60-7

Compare	Product No.	Description	SDS	Pricing
	401002

Match Criteria:Mot-clé

All Photos(1)

Teriparatide

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description	SDS	Pricing
	1643962	United States Pharmacopeia (USP) Reference Standard
	Y0001916	European Pharmacopoeia (EP) Reference Standard

Match Criteria:Mot-clé

All Photos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C₂₇₉H₃₂₆O₁₃₈

Molecular Weight:: 5887.49

Compare	Product No.	Description	SDS	Pricing
	806153	trimethylol propane core, generation 3

Match Criteria:Mot-clé

All Photos(1)

Glucagon-Like Peptide I human

Synonym(s): GLP-1, Preproglucagon 72-108

Empirical Formula (Hill Notation): C₁₈₆H₂₇₅N₅₁O₅₉

CAS No.:: 87805-34-3
Molecular Weight:: 4169.48

Compare	Product No.	Description	SDS	Pricing
	G3265	≥97% (HPLC)

Match Criteria:Mot-clé

All Photos(1)

Adrenocorticotropic Hormone human

Synonym(s): Adrenocorticotropic hormone fragment 1-39, Corticotropin A

Empirical Formula (Hill Notation): C₂₀₇H₃₀₈N₅₆O₅₈S

CAS No.:: 12279-41-3
Molecular Weight:: 4541.07

Compare	Product No.	Description	SDS	Pricing
	A0423	≥97% (HPLC)

Match Criteria:Mot-clé

All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	SML1150	≥98% (HPLC)

Match Criteria:Mot-clé

All Photos(1)

Parathyroid Hormone Fragment 1-34 human

Synonym(s): PTH 1-34, Parathormone (1-34)

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description	SDS	Pricing
	P3796	≥95% (HPLC), powder

Match Criteria:Mot-clé

Page 1 of 1