Skip to Content
Merck

E9644

Epidermal Growth Factor, human

≥97% (SDS-PAGE), recombinant, expressed in E. coli, lyophilized powder, suitable for cell culture

Synonym(s):

Epidermal Growth Factor human, EGF

Sign In to View Organizational & Contract Pricing.

Select a Size

0.2 MG

£187.00

0.5 MG

£270.00

5 X 0.2 MG

£662.00

£187.00


Please contact Customer Service for Availability


About This Item

CAS Number:
UNSPSC Code:
12352202
NACRES:
NA.77
MDL number:
Biological source:
human
Recombinant:
expressed in E. coli
Assay:
≥97% (SDS-PAGE)
Form:
lyophilized powder
Mol wt:
~6 kDa
Impurities:
≤1 EU/μg endotoxin (EGF)

Skip To

Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

hEGF, EGF, recombinant, expressed in E. coli, lyophilized powder, suitable for cell culture

SMILES string

S(CC[C@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H]%12N(CCC%12)C(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](N

InChI

1S/C270H401N73O83S7/c1-24-134(19)217(262(420)293-112-201(355)298-161(69-74-205(359)360)229(387)301-160(45-35-82-286-269(279)280)228(386)333-192(119-428)255(413)307-162(68-73-198(274)352)230(388)316-176(94-141-54-64-150(350)65-55-141)241(399)304-159(44-34-

InChI key

GVUGOAYIVIDWIO-UFWWTJHBSA-N

biological source

human

recombinant

expressed in E. coli

assay

≥97% (SDS-PAGE)

form

lyophilized powder

potency

0.08-0.8 ng/mL ED50/EC50

mol wt

~6 kDa

packaging

pkg of 5X0.2 mg, pkg of 0.2 mg, pkg of 0.5 mg

storage condition

avoid repeated freeze/thaw cycles

technique(s)

cell culture | mammalian: suitable

impurities

≤1 EU/μg endotoxin (EGF)

color

white

solubility

water: soluble, clear, colorless

UniProt accession no.

storage temp.

−20°C

Quality Level

Gene Information

human ... EGF(1950)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
E5036H1404H9661
assay

≥97% (SDS-PAGE)

assay

>97% (SDS-PAGE)

assay

>95% (SDS-PAGE)

assay

≥95% (SDS-PAGE)

technique(s)

cell culture | mammalian: suitable

technique(s)

-

technique(s)

cell culture | mammalian: suitable

technique(s)

cell culture | mammalian: suitable

biological source

human

biological source

human

biological source

human

biological source

human

recombinant

expressed in E. coli

recombinant

expressed in E. coli

recombinant

expressed in Baculovirus infected High-5 cells

recombinant

expressed in NSO cells

Quality Level

300

Quality Level

200

Quality Level

200

Quality Level

200

form

lyophilized powder

form

lyophilized powder

form

lyophilized powder

form

lyophilized powder

Application

This product is used as a mitogen, triggering the cell to commence mitosis, in a variety of cell lines. In tissue cultures, EGF acts to reduce or eliminate the requirement for serum and can be used in conjunction with other media additives and hormones.[1][2][3][4][5]

Biochem/physiol Actions

Epidermal Growth Factor (EGF) is a small mitogenic polypeptide present throughout a large number of tissues and body fluids in many mammalian species. EGF is a member of a growth factor family characterized by 6 conserved cysteine motifs that form three disulfide bonds. EGF is mitogenic for a variety of epidermal and epithelial cells, including fibroblasts, glial cells, vascular and corneal endothelial cells, bovine granulosa, HeLa cells, SV40-3T3 cells and mammary epithelial cells.
Cellular functions affected by EGF: mitosis, ion flux, glucose transport, glycolysis, nucleic acid and protein synthesis, survival, growth, proliferation and differentiation.
Biological affects of EGF: inhibition of gastric acid secretion, fetal growth and development and neuromodulation in the central nervous system.
Pathways affected by EGF: EGFR signaling, MAPK cascade, PIP, Ca+2 signaling

Preparation Note

This product was lyophilized from a 0.2 μm-filtered solution of phosphate buffered saline, at pH 7.4. It should be reconstituted by adding the contents of the vial to 1 mg/mL using 10 mM acetic acid. To dilute to lower concentrations, but no fewer than 10 μg/mL, an addition of 0.1% BSA or HSA will be needed. For use in proliferation assays, further dilute the sample with medium without albumin.

Analysis Note

The biological activity of this product is measured in a proliferation assay using BALB/MK cells. The EC50 is defined as the effective concentration of growth factor that elicits a 50% increase in cell growth in a cell based bioassay.

Other Notes

Human EGF (hEGF) is an identical molecule to β-urogastrone, a molecule isolated on the basis of its ability to inhibit gastric acid secretion. EGF is structurally homologous to human transforming growth factor-α, and both exert their actions through EGF receptors. E9644 is the N-terminal methionyl form of natural mature EGF.

Disclaimer

This product should be stored at -20°C and will retain activity for two years. After reconstitution, it can be stored at 2-8°C for one month, or frozen in aliquots at -70°C or -20°C for longer periods.

Storage Class

11 - Combustible Solids

wgk

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, type N95 (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Anita Alexa et al.
Proceedings of the National Academy of Sciences of the United States of America, 112(9), 2711-2716 (2015-03-03)
Mitogen-activated protein kinases (MAPKs) bind and activate their downstream kinase substrates, MAPK-activated protein kinases (MAPKAPKs). Notably, extracellular signal regulated kinase 2 (ERK2) phosphorylates ribosomal S6 kinase 1 (RSK1), which promotes cellular growth. Here, we determined the crystal structure of an
Piera Versura et al.
Investigative ophthalmology & visual science, 52(8), 5488-5496 (2011-04-19)
To investigate the immune response of human conjunctival epithelium to hyperosmolar stress. Tear osmolarity was measured in 15 normal subjects and 25 dry eye (DE) patients; conjunctival imprint cytology samples were obtained at the nasal bulbar area. Subconfluent primary human
Koji Teramoto et al.
Cellular signalling, 62, 109329-109329 (2019-06-04)
EphA2, which belongs to the Eph family of receptor tyrosine kinases, is overexpressed in a variety of human cancers. Serine 897 (S897) phosphorylation of EphA2 is known to promote cancer cell migration and proliferation in a ligand-independent manner. In this
Hossein Baharvand et al.
Molecular vision, 13, 1711-1721 (2007-10-26)
A new strategy of treating ocular surface reconstruction is to transplant a bioengineered graft by expanding limbal stem cells (SCs) ex vivo on the amniotic membrane (AM). The reasons for the exceptional success on the AM are not fully understood
Marzeih Ebrahimi et al.
Molecular vision, 16, 1680-1688 (2010-09-02)
The aim of this study is to create an ex vivo model to examine the expression of major heat-shock protein (HSP) families; HSP60, HSP72, and HSP90, and heat-shock cognate 70 (HCS70) at the mRNA and protein level in differentiating corneal

Articles

Organoid culture products to generate tissue and stem cell derived 3D brain, intestinal, gut, lung and cancer tumor organoid models.

Human pancreatic cancer organoid biobank (PDAC organoids) with various KRAS mutations to aide in 3D cell culture and cancer research applications.

Role of growth factors in stem cell differentiation and various growth factors for your research at sigmaaldrich.com

Protocols

A stem cell culture protocol to generate 3D NSC models of Alzheimer’s disease using ReNcell human neural stem cell lines.

Step-by-step culture protocols for neural stem cell culture including NSC isolation, expansion, differentiation and characterization.

Related Content

Monitor barrier formation using colon PDOs, iPSC-derived colon organoids, Millicell® cell culture inserts, and the Millicell® ERS. 3.0.

Instructions

Questions

1–8 of 8 Questions  
  1. what is the full peptide sequence of mature E9644 protein (~6kD)?

    1 answer
    1. The human EFG is synthesized as a long preproprotein of 1207 amino acids. The bioactive fragment (from amino acids 970 to 1023) is released by proteolytic cleavage. Please see the sequence below as well as the link to the Uniprot profile:
      https://www.uniprot.org/uniprotkb/P01133/entry
      NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

      Helpful?

  2. For the reconstitution in 10mM acetic acid and 0.1%BSA, do you use PBS or H20 for the rest of the solution?

    1 answer
    1. After the material is reconstituted in 10mM acetic acid, the material can be aliquoted and stored at 2-8°C for one month, or frozen in aliquots at -70°C or -20°C for longer periods. If the stock solution is very dilute, at a concentration less than 10 ug/mL, then BSA or HSA should be added to a concentration of 0.1% in the acetic acid solution prior to reconstitution in order to maintain the stability of the product.

      Helpful?

  3. What is the Department of Transportation shipping information for this product?

    1 answer
    1. Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.

      Helpful?

  4. Can I use PBS to reconstitute Epidermal Growth Factor (EGF) human, Product E9644?

    1 answer
    1. We recommend reconstitution with acetic acid to make sure the entire product will be solubilized.  PBS can be used, but the total amount of the protein in the vial may not go into solution.  It is best to make a higher concentration in acetic acid, and then dilute into PBS.

      Helpful?

  5. How long can I store a solution of Epidermal Growth Factor (EGF) human, Product E9644?

    1 answer
    1. Solution stability can be found on the product data sheet. If Product No. E9644 has been reconstituted with 0.2 micron-filtered 10 mM acetic acid containing 0.1% HSA or BSA to a concentration of not less than 10 ug/ml, it can be stored at 2-8 °C for a maximum of one month. For extended storage, freeze in working aliquots at -70 °C or -20 °C. Repeated freezing and thawing is not recommended.

      Helpful?

  6. What is the molecular weight of Epidermal Growth Factor (EGF) human, Product E9644?

    1 answer
    1. The mature protein has a molecular weight of 6 kD.

      Helpful?

  7. What is the difference between Product No. E9644 and E4269, Epidermal Growth Factor?

    1 answer
    1. Product No. E9644 is the mature EGF protein. Long EGF (Product No. E4269) is an analog of epidermal growth factor comprising the human EGF amino acid sequence plus a 53 amino acid N-terminal extension peptide. Long EGF has been developed as an inexpensive, high quality potent analog of EGF for use as a growth factor supplement for serum-free or low-serum cell culture.

      Helpful?

  8. Can Epidermal Growth Factor (EGF) human, Product E9644, be used on rat cells?

    1 answer
    1. This product has been tested for activity using the mouse Balb/3T3 cell line.  We have not tested its activity in rat cell culture, but we expect that will also work in that application.

      Helpful?

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service