

抗MBD3抗体 ウサギ宿主抗体

affinity isolated antibody







affinity isolated antibody

antibody product type

primary antibodies




buffered aqueous solution


33 kDa

species reactivity

mouse, human, guinea pig, rat, dog


0.5 mg - 1 mg/mL


western blot: suitable





wet ice



Gene Information

human ... MBD3(53615)


Synthetic peptide directed towards the N terminal region of human MBD3


DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). However, unlike the other family members, MBD3 is not capable of binding to methylated DNA. The predicted MBD3 protein shares 71% and 94% identity with MBD2 (isoform 1) and mouse Mbd3. MBD3 is a subunit of the NuRD, a multisubunit complex containing nucleosome remodeling and histone deacetylase activities. MBD3 mediates the association of metastasis-associated protein 2 (MTA2) with the core histone deacetylase complex.DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). However, unlike the other family members, MBD3 is not capable of binding to methylated DNA. The predicted MBD3 protein shares 71% and 94% identity with MBD2 (isoform 1) and mouse Mbd3. MBD3 is a subunit of the NuRD, a multisubunit complex containing nucleosome remodeling and histone deacetylase activities. MBD3 mediates the association of metastasis-associated protein 2 (MTA2) with the core histone deacetylase complex. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


Synthetic peptide located within the following region: SKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSN


Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


NONH for all modes of transport




Not applicable


Not applicable





LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon




© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.
