

Anti-SULT1B1, (N-terminal) antibody produced in rabbit

affinity isolated antibody

抗SULT2B1抗体, 抗MGC13356抗体, 抗ST1B2抗体






affinity isolated antibody

antibody product type

primary antibodies




buffered aqueous solution


35 kDa

species reactivity

pig, human, dog


0.5 mg - 1 mg/mL


western blot: suitable






wet ice



Gene Information

human ... SULT1B1(27284)


Synthetic peptide directed towards the N terminal region of human SULT1B1


SULT1B1 Catalyzes the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3′-diiodothyronine, triidothyronine, reverse triiodothyronine and thyroxine.Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. However, the total genomic length of this gene is greater than that of other SULT1 genes.


Synthetic peptide located within the following region: KRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFW


Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


NONH for all modes of transport




Not applicable


Not applicable





LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon




© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.
