

Anti-SH3GL1, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Anti-CNSA1, Anti-EEN, Anti-SH3P8, Anti-SH3D2B, Anti-MGC111371






affinity isolated antibody

antibody product type

primary antibodies




buffered aqueous solution


41 kDa

species reactivity

human, rat, dog, guinea pig, horse, bovine, mouse


0.5 mg - 1 mg/mL


western blot: suitable






wet ice



Gene Information

human ... SH3GL1(6455)


Synthetic peptide directed towards the N terminal region of human SH3GL1


Synthetic peptide located within the following region: LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES


Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


NONH for all modes of transport




Not applicable


Not applicable





LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon




© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.
