

Anti-ENPP2, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Anti-ATX-X, Anti-FLJ26803, Anti-NPP2, Anti-ATX, Anti-LysoPLD






affinity isolated antibody

antibody product type

primary antibodies




buffered aqueous solution


95 kDa

species reactivity

mouse, guinea pig, human, horse, dog, rat, rabbit


0.5 mg - 1 mg/mL


western blot: suitable






wet ice



Gene Information

human ... ENPP2(5168)


Synthetic peptide directed towards the N terminal region of human ENPP2


The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5′ end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas. The gene product is secreted and further processed to make the biologically active form. Several alternatively spliced transcript variants encoding different isoforms have been identified.


Synthetic peptide located within the following region: YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA


Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


NONH for all modes of transport




Not applicable


Not applicable

Se Jin Park et al.
American journal of rhinology & allergy, 28(3), 199-207 (2014-07-02)
Chronic sinusitis with nasal polyps (CRSwNPs) or CRS without NPs (CRSsNPs) is associated with expression of various cytokines. Lysophosphatidic acid (LPA) generated by autotaxin (ATX), LPA-producing enzyme, initiates signaling cascade involved in the inflammatory responses and participates in diverse biological...




LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon




© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.
