

Anti-KLRK1 antibody produced in rabbit

affinity isolated antibody







affinity isolated antibody

antibody product type

primary antibodies




buffered aqueous solution


24 kDa

species reactivity



0.5 mg - 1 mg/mL


western blot: suitable






wet ice



Gene Information

human ... KLRK1(22914)


The immunogen for anti-KLRK1 antibody: synthetic peptide derected towards the C terminal of human KLRK1


Synthetic peptide located within the following region: HIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNT


Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


NONH for all modes of transport




Not applicable


Not applicable

Laleh Talebian et al.
Transfusion, 54(6), 1515-1521 (2014-01-23)
The NKG2D receptor, one of the natural killer (NK) cell-activating receptors, is expressed on the surface of CD3+CD8+ T cells, γδ+ T cells, NK cells, NKT cells, and a few CD4+ T cells. We show, for the first time, a...
Hongshuang Ma et al.
Clinical rheumatology, 33(11), 1603-1610 (2014-07-16)
Imbalance of natural killer (NK) cells is associated with the development of systemic lupus erythematosus (SLE). However, little is known about the dynamic changes on NK cells following therapy. This study aimed at examining the impact of classic therapies on...
Javier Celis-Gutierrez et al.
The EMBO journal, 33(17), 1928-1940 (2014-06-26)
Natural killer (NK) cells are involved in immune responses against tumors and microbes. NK-cell activation is regulated by intrinsic and extrinsic mechanisms that ensure NK tolerance and efficacy. Here, we show that the cytoplasmic signaling molecules Dok1 and Dok2 are...




LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon




© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.
