

抗NME1抗体 ウサギ宿主抗体

affinity isolated antibody







affinity isolated antibody

antibody product type

primary antibodies




buffered aqueous solution



species reactivity

horse, rabbit, human, rat, bovine, mouse


0.5 mg - 1 mg/mL


dot blot: suitable
immunoblotting: suitable
immunohistochemistry: suitable






wet ice



Gene Information

human ... NME1(4830)


NME1 (nonmetastatic cells 1) is also known as NM23/NM23-H1. It belongs to the NM23 family. NM23-H1 codes for the A subunit of nucleoside diphosphate kinase. It is located on human chromosome 17q21.


Synthetic peptide directed towards the N terminal region of human NME1


NME1 (nonmetastatic cells 1) participates in cellular proliferation, differentiation, motility, tumor metastasis, adhesion, polymerization, signal transduction pathway and vascular invasion. It maintains the intracellular nucleotide homeostasis. NM23 possesses several enzymatic activities like histidine kinase, transcriptional activation and exonuclease activities.


Synthetic peptide located within the following region: ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEH


Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


NONH for all modes of transport




Not applicable


Not applicable

Breast Cancer Metastasis Suppressor 1 (BRMS1): Robust Biological and Pathological Data, But Still Enigmatic Mechanism of Action
Advances in Cancer Research, 132, 111-137 (2016)
Low expression of nm23-H1 associates with poor survival of nasopharyngeal carcinoma patients: A prisma-compliant meta-analysis
Yuan C, et al.
Medicine, 96(24) (2017)
Localization of a second NM23 gene, NME2, to chromosome 17q21-q22
Kelsell DP, et al.
Genomics, 17(2), 522-524 (1993)
Meta-Analysis of the Relationship between NM23 Expression to Gastric Cancer Risk and Clinical Features
Fang M, et al.
BioMed Research International, 2017 (2017)




LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon




© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.
