Todas las fotos(1)

APREST84097

Sigma-Aldrich

PrEST Antigen LZTFL1

Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution

Nivel de calidad

100

recombinante

expressed in E. coli

ensayo

>80% (SDS-PAGE)

formulario

buffered aqueous solution

mol peso

predicted mol wt 26 kDa

purificado por

immobilized metal affinity chromatography (IMAC)

concentración

≥0.5 mg/mL

secuencia del inmunógeno

NTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAPLNEGGTAELLN

Ensembl | nº de acceso humano

Nº de acceso UniProt

enviado en

wet ice

temp. de almacenamiento

−20°C

Gene Information

human ... LZTFL1(54585)

Descripción general

Recombinant protein fragment of Human LZTFL1 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Aplicación

Suitable as a blocking agent using corresponding antibodies.

Ligadura / enlace

Corresponding Antibody HPA043466.

Forma física

Solution in 1 M urea-PBS, pH 7.4

Nota de preparación

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Información legal

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Código de clase de almacenamiento

12 - Non Combustible Liquids

WGK

WGK 2

Punto de inflamabilidad F

Not applicable

Punto de inflamabilidad C

Not applicable

Certificado de Análisis

Certificado de origen

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico