HPA010738

Sigma-Aldrich

Anti-ADAM17 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:
Anti-ADAM 17 precursor antibody produced in rabbit, Anti-A disintegrin and metalloproteinase domain 17 antibody produced in rabbit, Anti-CD156b antigen antibody produced in rabbit, Anti-Snake venom-like protease antibody produced in rabbit, Anti-TNF-α convertase antibody produced in rabbit, Anti-TNF-α-converting enzyme antibody produced in rabbit
MDL number:
Human Protein Atlas Number:

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

application(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

SEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYR

conjugate

unconjugated

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... ADAM17(6868)

Categorías relacionadas

General description

A disintegrin and metallopeptidase domain 17 (ADAM17) belongs to ADAM family of genes, which has a characteristic cysteine rich region called disintegrin and a metalloproteinase domain. This gene is located on chromosome 2, spans 55kb and has 9 exons. In adult humans, ADAM17 is expressed on multiple tissues such as, heart, muscle, kidney, placenta, pancreas, thymus, small intestine, ovaries, testes and prostate. In fetus, it is expressed in brain, lung, liver and kidney.

Immunogen

ADAM 17 precursor recombinant protein epitope signature tag (PrEST)

Biochem/physiol Actions

ADAMs (A disintegrin and metallopeptidases) are called ectodomain sheddases and ADAM17 is an angiotensin-converting enzyme 2 (ACE2) sheddase. It also processes and sheds multiple cell surface molecules such as, adhesion molecules and cytokines. It produces the soluble form of tumor necrosis factor α (TNF-α), along with the processing of I-CAM, V-CAM, IL-6R, L-selectin etc. These, in turn, play a role in development, regeneration and inflammation of the circulatory system. Polymorphism rs12692386 in ADAM17 gene is associated with an increased susceptibility to abdominal aortic aneurysm. This gene is also up-regulated in myocardial infarction patients, as well as in atherosclerosis patients. It also plays a role in the pathophysiology of ischemic strokes (IS). ADAM17 aids in tumor progression by facilitating tumor proliferation and invasion, as in the case of non-small cell lung cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72102.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Personal Protective Equipment

dust mask type N95 (US),Eyeshields,Gloves

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Flash Point F

Not applicable

Flash Point C

Not applicable

Certificado de Análisis

Certificado de origen

Henriette Ebsen et al.
PloS one, 8(10), e76853-e76853 (2013-10-17)
A disintegrin and metalloproteases (ADAMs) have been implicated in many processes controlling organismic development and integrity. Important substrates of ADAM proteases include growth factors, cytokines and their receptors and adhesion proteins. The inducible but irreversible cleavage of their substrates alters...
Xiaohong Lv et al.
Molecular medicine reports, 9(5), 1935-1940 (2014-03-15)
A disintegrin and metalloprotease (ADAM) 17 has been implicated in the tumor progression of various types of solid tumor; however, little is known about its role in non-small cell lung carcinoma (NSCLC). The present study evaluated whether the downregulation of...
Tie-cheng Zhang et al.
Medical oncology (Northwood, London, England), 29(4), 2684-2690 (2011-12-06)
A disintegrin and metalloproteinase-17 (ADAM17, also named as tumor necrosis factor-alpha-converting enzyme) is a member of the ADAM family. Of all ADAMs, the strongest evidence for a role in malignancy exists for ADAM17. Especially, it has been demonstrated that ADAM17...
You Li et al.
Journal of atherosclerosis and thrombosis, 21(8), 878-893 (2014-04-15)
Stroke is a leading cause of death and disability worldwide. Most ischemic strokes (IS) are caused by atherosclerosis. Recently, the pivotal role of ADAM17 in atherosclerosis has been thoroughly addressed. However, the association between ADAM17 and IS has not yet...
You Li et al.
Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology, 33(5), 1426-1438 (2014-05-24)
Accumulating evidence suggests that the principal TNF-α converting enzyme, a disintegrin and metalloproteinase 17 (ADAM17), is involved in the development of human abdominal aortic aneurysm (AAA). However, the association between ADAM17 gene polymorphisms and AAA has not been explored. The...

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico

Redes sociales

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Investigación. Desarrollo. Producción.

Somos un proveedor líder para la industria de Ciencias de la Vida con soluciones y servicios para investigación, desarrollo y producción biotecnológicos, y para desarrollo y producción de tratamientos farmacéuticos

© 2021 Merck KGaA, Darmstadt, Alemania y/o sus filiales. Todos los derechos reservados.

Queda estrictamente prohibida la reproducción sin permiso de cualquiera de los materiales de la página web.