Merck

HPA022040

Sigma-Aldrich

Anti-RUNX2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Iniciar sesiónto View Organizational & Contract Pricing

Sinónimos:
RUNX2 Antibody - Anti-RUNX2 antibody produced in rabbit, Runx2 Antibody, Anti-Acute myeloid leukemia 3 protein, Anti-CBF-alpha-1, Anti-Core-binding factor subunit alpha-1, Anti-OSF-2, Anti-Oncogene AML-3, Anti-PEA2-alpha A, Anti-PEBP2-alpha A, Anti-Polyomavirus enhancer-binding protein 2 alpha A subunit, Anti-Runt-related transcription factor 2, Anti-SL3-3 enhancer factor 1 alpha A subunit, Anti-SL3/AKV core-binding factor alpha A subunit
Número MDL:
Atlas de proteínas humanas número:

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

antibody product type

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

formulario

buffered aqueous glycerol solution

species reactivity

human

envase

antibody small pack of 25 μL

validación mejorada

RNAi knockdown
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

secuencia del inmunógeno

LNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASELGPFSDPRQFPSISSLTESRFSNPRMHYPA

Nº de acceso UniProt

application(s)

research pathology

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

target post-translational modification

unmodified

Gene Information

human ... RUNX2(860)

Comparar elementos similares

Ver comparación completa

Mostrar Diferencias

1 of 4

Este artículo
R0406ZRB1936SAB3500417
conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

purified antibody

antibody form

affinity isolated antibody

clone

polyclonal

clone

polyclonal

clone

1C18, recombinant monoclonal

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

-

product line

ZooMAb® learn more

product line

-

form

buffered aqueous glycerol solution

form

buffered aqueous solution

form

lyophilized

form

buffered aqueous solution

Still not finding the right product?  

Give our Product Selector Tool a try.

Descripción general

Runt-related transcription factor 2/acute myeloid leukemia 3 protein (RUNX2, AML-3) belongs to Runt DNA-binding domain transcription factor family. RUNX2 gene is mapped to human chromosome 6p21.1 RUNX2 possesses the Runt domain, nuclear localization signal (NLS), the nuclear matrix targeting signal (NMTS) and a C-terminal VWRPY sequence. It also has two additional domains, one being the N-terminal glutamine-alanine (QA) repeats and the other a C-terminal proline/serine/threonine (PST) rich tract. RUNX2 exists in two isoforms. The isoform 1 is expressed in osteoblasts and the isoform 2 is distributed in mesenchymal condensations and mature chondrocytes.
Runt-related transcription factor 2/acute myeloid leukemia 3 protein (RUNX2, AML-3) is a Runt DNA-binding domain transcription factor that facilitates osteoblast differentiation and skeletal morphogenesis.

Especificidad

Rabbit polyclonal anti-RUNX2 antibody reacts with human runt-related transcription factor 2/Acute myeloid leukemia 3 protein.

Inmunógeno

Runt-related transcription factor 2 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-RUNX2 antibody produced in rabbit has been used in immunohistochemistry and immunofluorescence.
Rabbit polyclonal anti-RUNX2 antibody is used to tag Runt-related transcription factor 2/Acute myeloid leukemia 3 protein for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of runt-related transcription factor 2/Acute myeloid leukemia 3 protein in osteoblast differentiation and skeletal morphogenesis.

Acciones bioquímicas o fisiológicas

Runt-related transcription factor 2/ acute myeloid leukemia 3 protein (RUNX2, AML-3) mediates osteoblast differentiation and skeletal morphogenesis. It promotes mesenchymal cell differentiation in osteoblasts and its maturation. Elevated levels of RUNX2 is observed in bone?metastatic cancers. The post-translational modifications like phosphorylation, methylation, glycosylation and ubiquitination in the RUNX2 modulates osteogenesis. Mutations in the RUNX2 gene leading to loss of function is implicated in cleidocranial dysplasia (CCD). The levels of RUNX2 is elevated in osteosarcoma.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST86701.

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Las referencias de los producto se combinan con los tamaños de envase y las cantidades cuando se muestran en la página web, por ejemplo: T1503-25G. Asegúrese de introducir el número de producto ÚNICAMENTE en el campo del Número de producto (ejemplo: T1503).

Ejemplo

T1503
Referencia del producto
-
25G
Tamaño del envase/cantidad

Otros ejemplos

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

introducir como 1.000309185)

¿Tiene algún problema? No dude en ponerse en contacto con nosotros Servicio técnico para asistencia

Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch».

Productos Aldrich

  • Si encuentra un número de lote como TO09019TO, introduzca el número de lote 09019TO sin las dos primeras letras.

  • Si encuentra un número de lote con un código de entrada como 05427ES-021, introduzca el número 05427ES sin el código de entrada -021.

  • Si encuentra un número de lote con un código de entrada como STBB0728K9, introduzca el código de lote STBB0728 sin el código de entrada K9.

¿No ha encontrado lo que estaba buscando?

En algunos casos, puede que un COA no esté disponible en la página web. Si su búsqueda no encontró el COA puede solicitarlo.

Solicitar COA

Greg Holmes et al.
Gene expression patterns : GEP, 17(1), 16-25 (2014-12-17)
Sutures, where neighboring craniofacial bones are separated by undifferentiated mesenchyme, are major growth sites during craniofacial development. Pathologic fusion of bones within sutures occurs in a wide variety of craniosynostosis conditions and can result in dysmorphic craniofacial growth and secondary
Time-dependent regulation of morphological changes and cartilage differentiation markers in the mouse pubic symphysis during pregnancy and postpartum recovery
Castelucci BG, et al.
Testing, 13(4), e0195304-e0195304 (2018)
Midface and upper airway dysgenesis in FGFR2-related craniosynostosis involves multiple tissue-specific and cell cycle effects
Holmes G, et al.
Development, 145(19), e0201492-e0201492 (2018)
Lindsay A Dawson et al.
Wound repair and regeneration : official publication of the Wound Healing Society [and] the European Tissue Repair Society, 29(1), 196-205 (2020-08-21)
Complete extremity regeneration in mammals is restricted to distal amputations of the digit tip, the terminal phalanx (P3). In mice, P3 regeneration is mediated via the formation of a blastema, a transient population of progenitor cells that form from the
Bianca Gazieri Castelucci et al.
PloS one, 13(4), e0195304-e0195304 (2018-04-06)
Animal models commonly serve as a bridge between in vitro experiments and clinical applications; however, few physiological processes in adult animals are sufficient to serve as proof-of-concept models for cartilage regeneration. Intriguingly, some rodents, such as young adult mice, undergo

Artículos

Mesenchymal stem cell markers and antibodies suitable for investigating targets in fibroblasts, chondrocytes, adipocytes, osteoblasts, and muscle cells.

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico