Merck

HPA023040

Sigma-Aldrich

Anti-KRT14 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Iniciar sesiónto View Organizational & Contract Pricing

Select a Size

Sinónimos:
Anti-CK-14, Anti-Cytokeratin-14, Anti-K14, Anti-Keratin, type I cytoskeletal 14, Anti-Keratin-14
Atlas de proteínas humanas número:

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

antibody product type

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

formulario

buffered aqueous glycerol solution

species reactivity

human

envase

antibody small pack of 25 μL

validación mejorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:1000-1:2500

secuencia del inmunógeno

TYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN

Nº de acceso UniProt

enviado en

wet ice

temp. de almacenamiento

−20°C

target post-translational modification

unmodified

Gene Information

human ... KRT14(3861)

Comparar elementos similares

Ver comparación completa

Mostrar Diferencias

1 of 4

Este artículo
HPA055835HPA001605HPA023910
conjugate

unconjugated

conjugate

unconjugated

conjugate

-

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

clone

polyclonal

clone

polyclonal

clone

polyclonal

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

form

buffered aqueous glycerol solution

form

buffered aqueous glycerol solution

form

buffered aqueous glycerol solution

Descripción general

CK14/ KRT14 (keratin 14) is one of the cytokeratin isotypes of human cells. It is an intermediate filament protein. It is located on human chromosome 17q21.

Inmunógeno

Keratin, type I cytoskeletal 14 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-KRT14 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Acciones bioquímicas o fisiológicas

CK14/ KRT14 (keratin 14) participates in collective invasion of salivary adenoid cystic carcinoma (SACC). Mutations in KRT14 results in epidermolysis bullosa simplex.
KRT14 (keratin 14) is required for the generation of a perinuclear structure of keratin filaments in keratinocytes. It is a key player in the assembly, organization and dynamics of keratin filaments. Mutations in KRT14 are associated with epidermolysis bullosa simplex. The gene is mapped to human chromosome 17q21.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST75948.

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Código de clase de almacenamiento

10 - Combustible liquids

WGK

WGK 1

Punto de inflamabilidad F

Not applicable

Punto de inflamabilidad C

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Las referencias de los producto se combinan con los tamaños de envase y las cantidades cuando se muestran en la página web, por ejemplo: T1503-25G. Asegúrese de introducir el número de producto ÚNICAMENTE en el campo del Número de producto (ejemplo: T1503).

Ejemplo

T1503
Referencia del producto
-
25G
Tamaño del envase/cantidad

Otros ejemplos

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

introducir como 1.000309185)

¿Tiene algún problema? No dude en ponerse en contacto con nosotros Servicio técnico para asistencia

Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch».

Productos Aldrich

  • Si encuentra un número de lote como TO09019TO, introduzca el número de lote 09019TO sin las dos primeras letras.

  • Si encuentra un número de lote con un código de entrada como 05427ES-021, introduzca el número 05427ES sin el código de entrada -021.

  • Si encuentra un número de lote con un código de entrada como STBB0728K9, introduzca el código de lote STBB0728 sin el código de entrada K9.

¿No ha encontrado lo que estaba buscando?

En algunos casos, puede que un COA no esté disponible en la página web. Si su búsqueda no encontró el COA puede solicitarlo.

Solicitar COA

Julian Schwebler et al.
Scientific reports, 13(1), 12261-12261 (2023-07-29)
In vitro culture and generation of highly specialized goblet cells is still a major challenge in conjunctival 3D in vitro equivalents. A model comprising all physiological factors, including mucus-secreting goblet cells has the potential to act as a new platform
Jouni Uitto et al.
The Journal of investigative dermatology, 136(2), 352-358 (2016-01-24)
Epidermolysis bullosa (EB), a group of complex heritable blistering diseases, is the topic of triennial research meetings organized by DEBRA International, Vienna, Austria, the network of national EB patient advocacy organizations. The DEBRA 2015 Research Conference, held in May 2015
Anna Leikeim et al.
Scientific reports, 12(1), 16269-16269 (2022-09-30)
Malignant melanoma is among the tumor entities with the highest increase of incidence worldwide. To elucidate melanoma progression and develop new effective therapies, rodent models are commonly used. While these do not adequately reflect human physiology, two-dimensional cell cultures lack
Novel de novo mutation in KRT14 underlies a localized form of epidermolysis bullosa simplex.
Monika Ołdak et al.
European journal of dermatology : EJD, 23(3), 404-406 (2013-06-19)
Angela Rossi et al.
Journal of visualized experiments : JoVE, (96)(96), doi:10-doi:10 (2015-03-06)
In vitro models are a cost effective and ethical alternative to study cutaneous wound healing processes. Moreover, by using human cells, these models reflect the human wound situation better than animal models. Although two-dimensional models are widely used to investigate

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico