Merck
Todas las fotos(7)

HPA029906

Sigma-Aldrich

Anti-PLEC antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab2

Sinónimos:
Anti-CLTCL2, Anti-EBS1, Anti-Hc, Anti-PCN, Anti-PLEC1, Anti-PLTN, Anti-plectin 1, intermediate filament binding protein
Atlas de proteínas humanas número:

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

antibody product type

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

formulario

buffered aqueous glycerol solution

species reactivity

human

envase

antibody small pack of 25 μL

validación mejorada

orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

secuencia del inmunógeno

TEIIRQQGLASYDYVRRRLTAEDLFEARIISLETYNLLREGTRSLREALEAESAWCYLYGTGSVAGVYLPGSRQTLSIYQALKKGLLSAEVARLLLEAQAA

enviado en

wet ice

temp. de almacenamiento

−20°C

Gene Information

human ... PLEC1(5339)

Categorías relacionadas

Comparar elementos similares

Ver comparación completa

Show Differences

1 of 4

Este artículo
HPA025967P9318SAB4301219
conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

conjugate

-

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

ascites fluid

antibody form

affinity isolated antibody

clone

polyclonal

clone

polyclonal

clone

7A8, monoclonal

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

-

product line

-

form

buffered aqueous glycerol solution

form

buffered aqueous glycerol solution

form

-

form

buffered aqueous solution

Descripción general

Plec (plectin) is an important cytolinker. It is located on human chromosome 8q24.1 and has 32 exons. It is expressed in various tissues including skin and muscle.

Inmunógeno

plectin 1, intermediate filament binding protein 500kDa recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Acciones bioquímicas o fisiológicas

Mutations in PLEC cause different types of epidermolysis bullosa (EB), including autosomal-dominant inherited EB simplex Ogna (EBSOG), EB simplex with muscular dystrophy (EBS-MD) and pyloric atresia (EBS-PA).

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST76467.

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Código de clase de almacenamiento

10 - Combustible liquids

WGK

WGK 1

Punto de inflamabilidad F

Not applicable

Punto de inflamabilidad C

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Las referencias de los producto se combinan con los tamaños de envase y las cantidades cuando se muestran en la página web, por ejemplo: T1503-25G. Asegúrese de introducir el número de producto ÚNICAMENTE en el campo del Número de producto (Ejemplo T1503).

Ejemplo

T1503
Referencia del producto
-
25G
Tamaño del envase/cantidad

Otros ejemplos

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

introducir como1.000309185)

¿Tiene algún problema? No dude en ponerse en contacto con nosotros Servicio técnico para asistencia

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Productos Aldrich

  • Si encuentra un número de lote como TO09019TO, introduzca el número de lote 09019TO sin las dos primeras letras.

  • Si encuentra un número de lote con un código de entrada como 05427ES-021, introduzca el número 05427ES sin el código de entrada -021.

  • Si encuentra un número de lote con un código de entrada como STBB0728K9, introduzca el código de lote STBB0728 sin el código de entrada K9.

¿No ha encontrado lo que estaba buscando?

En algunos casos, puede que un COA no esté disponible en la página web. Si su búsqueda no encontró el COA puede solicitarlo.

Solicitar COA

Hulya Gundesli et al.
American journal of human genetics, 87(6), 834-841 (2010-11-27)
Limb-girdle muscular dystrophy (LGMD) is a genetically heterogeneous group of inherited muscular disorders manifesting symmetric, proximal, and slowly progressive muscle weakness. Using Affymetrix 250K SNP Array genotyping and homozygosity mapping, we mapped an autosomal-recessive LGMD phenotype to the telomeric portion

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico