WH0001364M1

Sigma-Aldrich

Monoclonal Anti-CLDN4 antibody produced in mouse

clone 4A4, purified immunoglobulin, buffered aqueous solution

Sinónimos:
Anti-CPER, Anti-hCPER, Anti-CPETR1, Anti-claudin 4, Anti-WBSCR8, Anti-CPETR
MDL number:
En este momento no podemos mostrarle ni los precios ni la disponibilidad

biological source

mouse

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4A4, monoclonal

form

buffered aqueous solution

species reactivity

human

application(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: suitable

isotype

IgG3κ

immunogen sequence

MWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQ* (without GST)

conjugate

unconjugated

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... CLDN4(1364)

Immunogen

CLDN4 (NP_001296, a.a. 29-79) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.

Physical form

Solution in phosphate buffered saline, pH 7.2

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Personal Protective Equipment

dust mask type N95 (US),Eyeshields,Gloves

RIDADR

NONH for all modes of transport

Certificado de Análisis
Kaitlin A G Reeh et al.
Development (Cambridge, England), 141(15), 2950-2958 (2014-07-24)
The thymus and parathyroid glands arise from a shared endodermal primordium in the third pharyngeal pouch (3rd pp). Thymus fate is specified in the ventral 3rd pp between E9.5 and E11, whereas parathyroid fate is specified in the dorsal domain....

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico

Redes sociales

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Investigación. Desarrollo. Producción.

Somos un proveedor líder para la industria de Ciencias de la Vida con soluciones y servicios para investigación, desarrollo y producción biotecnológicos, y para desarrollo y producción de tratamientos farmacéuticos

© 2021 Merck KGaA, Darmstadt, Alemania y/o sus filiales. Todos los derechos reservados.

Queda estrictamente prohibida la reproducción sin permiso de cualquiera de los materiales de la página web.