Merck
All Photos(3)

WH0055802M6

Sigma-Aldrich

Monoclonal Anti-DCP1A antibody produced in mouse

clone 3G4, purified immunoglobulin, buffered aqueous solution

Synonym(s):
Anti-DCP1 decapping enzyme homolog A (S. cerevisiae), Anti-HSA275986, Anti-Nbla00360, Anti-SMAD4IP1, Anti-SMIF
NACRES:
NA.41

origen biológico

mouse

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

antibody product type

primary antibodies

clon

3G4, monoclonal

formulario

buffered aqueous solution

species reactivity

mouse, rat, human

technique(s)

ELISA: suitable
capture ELISA: suitable
immunofluorescence: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

GenBank® accession no.

Nº de acceso UniProt

enviado en

dry ice

temp. de almacenamiento

−20°C

Gene Information

human ... DCP1A(55802)

Descripción general

Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. (provided by RefSeq)

Inmunógeno

DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Código de clase de almacenamiento

12 - Non Combustible Liquids

WGK

WGK 1

Punto de inflamabilidad F

Not applicable

Punto de inflamabilidad C

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service