Merck
Search Within
Categoría de producto
Marca
Fuente biológica
Punto de ebullición [° C]
Característica
Peso de la fórmula
Alias del gen
Fabricante
Punto de fusión [° C]
Forma física
Pureza
Espectro de actividad
Agencia
Formato
Nivel de calidad
Aplicación
API Family
Reference Material Type
Técnica
Disponible para la venta

231-175-3

Filtros aplicados
Palabra clave:'231-175-3'
Mostrando 1-30 of 46 resultados para "231-175-3" en el plazo de Productos
CompararReferencia del productoDescripciónSDSPrecios
BCR326BCR®, certified reference material
BCR327BCR®, certified reference material
Todas las fotos(11)

Empirical Formula (Hill Notation): Zn
CAS No.:
7440-66-6
Peso molecular:
65.39
EC No.:
231-175-3
Todas las fotos(1)

Exenatide

Sinónimos: Exendin-4
Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Peso molecular:
4186.57
CompararReferencia del productoDescripciónPrecios
1269105United States Pharmacopeia (USP) Reference Standard
Todas las fotos(1)

Teriparatide for system suitability

Sinónimos: Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Peso molecular:
4117.72
CompararReferencia del productoDescripciónPrecios
Y0001895European Pharmacopoeia (EP) Reference Standard
Todas las fotos(1)

Sinónimos: Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Peso molecular:
4117.72
Todas las fotos(1)

Exendin-4

Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Peso molecular:
4186.57
CompararReferencia del productoDescripciónSDSPrecios
E7144≥97%
Todas las fotos(1)

ProteoMass Insulin chain B oxidized MALDI-MS Standard

Sinónimos: Insulin Chain B Oxidized from bovine pancreas
Empirical Formula (Hill Notation): C157H232N40O47S2
CAS No.:
30003-72-6
Peso molecular:
3495.89
CompararReferencia del productoDescripciónSDSPrecios
I6154vial of 10 nmol
Todas las fotos(1)

Hyperbrached bis-MPA polyester-32-hydroxyl, generation 3

Sinónimos: Hyperbranched Polymer, Hyperpolymer
Empirical Formula (Hill Notation): C155H256O93
CAS No.:
326794-48-3
Peso molecular:
3607.64
CompararReferencia del productoDescripciónSDSPrecios
686581≥97%
Todas las fotos(1)

Empirical Formula (Hill Notation): C157H232N40O47S2
CAS No.:
30003-72-6
Peso molecular:
3495.89
CompararReferencia del productoDescripciónSDSPrecios
I1764BioReagent, suitable for protein sequencing
I6383≥80% (HPLC), powder
Todas las fotos(1)

Parathyroid Hormone Fragment 1-34 human

Sinónimos: PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Peso molecular:
4117.72
CompararReferencia del productoDescripciónSDSPrecios
P3796≥95% (HPLC), powder
Todas las fotos(1)

Astressin

Sinónimos: [D-Phe12, Nle21,38, Glu30, Lys33]-Corticotropin Releasing Factor fragment 12-41
Empirical Formula (Hill Notation): C161H269N49O42
CAS No.:
170809-51-5
Peso molecular:
3563.16
CompararReferencia del productoDescripciónSDSPrecios
A4933≥90% (HPLC)
Todas las fotos(1)

Cecropin B

Empirical Formula (Hill Notation): C176H301N51O42S
CAS No.:
80451-05-4
Peso molecular:
3835.65
CompararReferencia del productoDescripciónSDSPrecios
C1796≥97% (HPLC), powder
Todas las fotos(1)

Diabetes Associated Peptide Amide human

Sinónimos: Amylin, DAP, IAPP, Insulinoma or Islet amyloid polypeptide
Empirical Formula (Hill Notation): C165H261N51O55S2
CAS No.:
122384-88-7
Peso molecular:
3903.28
CompararReferencia del productoDescripciónSDSPrecios
D2162≥97% (HPLC)
Todas las fotos(1)

Exendin Fragment 9-39

Empirical Formula (Hill Notation): C149H234N40O47S
CAS No.:
133514-43-9
Peso molecular:
3369.76
CompararReferencia del productoDescripciónSDSPrecios
E7269≥95% (HPLC)
Todas las fotos(1)

Human glucagon

Sinónimos: Glucagon
Empirical Formula (Hill Notation): C153H225N43O49S
CAS No.:
9007-92-5
Peso molecular:
3482.75
CompararReferencia del productoDescripciónPrecios
Y0000191European Pharmacopoeia (EP) Reference Standard
Todas las fotos(1)

Margatoxin

Sinónimos: MgTx
Empirical Formula (Hill Notation): C178H286N52O50S7
CAS No.:
145808-47-5
Peso molecular:
4178.95
CompararReferencia del productoDescripciónSDSPrecios
M8278
Todas las fotos(1)

Calcitonin Gene Related Peptide human

Sinónimos: α-CGRP, CGRP-I
Empirical Formula (Hill Notation): C163H267N51O49S2
CAS No.:
90954-53-3
Peso molecular:
3789.31
CompararReferencia del productoDescripciónSDSPrecios
C0167≥95% (HPLC), powder
Todas las fotos(1)

Cecropin A

Empirical Formula (Hill Notation): C184H313N53O46
CAS No.:
80451-04-3
Peso molecular:
4003.78
CompararReferencia del productoDescripciónSDSPrecios
C6830≥97% (HPLC), powder
Todas las fotos(1)

Parathyroid Hormone Fragment 1-34 bovine

Empirical Formula (Hill Notation): C183H288N54O50S2
CAS No.:
12583-68-5
Peso molecular:
4108.71
CompararReferencia del productoDescripciónSDSPrecios
P3671≥97% (HPLC), powder
Todas las fotos(1)

Chlorotoxin from Leiurus quinquestriatus (north Africa)

Empirical Formula (Hill Notation): C158H256N52O48S11
CAS No.:
163515-35-3
Peso molecular:
4004.76
CompararReferencia del productoDescripciónSDSPrecios
C5238recombinant, expressed in E. coli, ≥98% (HPLC), lyophilized powder
Todas las fotos(1)

Orexin A human, rat, mouse

Empirical Formula (Hill Notation): C152H243N47O44S4
CAS No.:
205599-75-3
Peso molecular:
3561.10
CompararReferencia del productoDescripciónSDSPrecios
O6012≥97% (HPLC)
Todas las fotos(1)

Pramlintide acetate salt

Sinónimos: 25,28,29 TriPro-amylin (human) acetate, AC 0137, AC 137, AC0137, AC137, TriPro-amylin acetate, [Pro25,28,29]-amylin (human) acetate
Empirical Formula (Hill Notation): C171H267N51O53S2
CAS No.:
187887-46-3
Peso molecular:
3949.39
CompararReferencia del productoDescripciónSDSPrecios
SML2523≥95% (HPLC)
Todas las fotos(1)

Calcitonin human

Sinónimos: Calcitonin M, human C carcinoma, Calcitonin, human reduced cyclic (1→7)-disulfide, Thyrocalcitonin, hCT
Empirical Formula (Hill Notation): C151H226N40O45S3
CAS No.:
21215-62-3
Peso molecular:
3417.85
EC No.:
244-276-2
CompararReferencia del productoDescripciónSDSPrecios
T3535≥97% (HPLC), powder
Todas las fotos(1)

Adrenocorticotropic Hormone human

Sinónimos: Adrenocorticotropic hormone fragment 1-39, Corticotropin A
Empirical Formula (Hill Notation): C207H308N56O58S
CAS No.:
12279-41-3
Peso molecular:
4541.07
CompararReferencia del productoDescripciónSDSPrecios
A0423≥97% (HPLC)
Todas las fotos(1)

Cecropin P1 Porcine

Empirical Formula (Hill Notation): C147H253N45O43
CAS No.:
125667-96-1
Peso molecular:
3338.86
CompararReferencia del productoDescripciónSDSPrecios
C7927≥95% (HPLC), powder
Todas las fotos(1)

SNX-482 Recombinant

Sinónimos: GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Peso molecular:
4495.00
CompararReferencia del productoDescripciónSDSPrecios
SML1150≥98% (HPLC)
Todas las fotos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C279H326O138
Peso molecular:
5887.49
CompararReferencia del productoDescripciónSDSPrecios
806153trimethylol propane core, generation 3
Todas las fotos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C176H277N57O55S7
CAS No.:
95751-30-7
Peso molecular:
4295.89
CompararReferencia del productoDescripciónSDSPrecios
C7802≥90% (HPLC)
Todas las fotos(1)

Glucagon-Like Peptide I human

Sinónimos: GLP-1, Preproglucagon 72-108
Empirical Formula (Hill Notation): C186H275N51O59
CAS No.:
87805-34-3
Peso molecular:
4169.48
CompararReferencia del productoDescripciónSDSPrecios
G3265≥97% (HPLC)
Todas las fotos(1)

Neuropeptide Y human

Sinónimos: NPY, hNPY
Empirical Formula (Hill Notation): C189H285N55O57S
CAS No.:
90880-35-6
Peso molecular:
4271.68
CompararReferencia del productoDescripciónSDSPrecios
N5017≥95% (HPLC), powder, synthetic
Página 1 de 2