AV02008

Anti-BCL2L1 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-BCL2-like 1
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 26 kDa
• species reactivity: canine, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_612815
• UniProt accession no.: Q07817
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... BCL2L1(598)

Description

General description

BCL2L1 is a signaling molecule that is known to regulate neuronal apoptosis. Furthermore, BCL2L1 can facilitate the survival of retinal ganglion cells.
Rabbit Anti-BCL2L1 associates with bovine, human, rabbit, canine, and pig BCL2L1.

Immunogen

Synthetic peptide directed towards the N terminal region of human BCL2L1

Application

Rabbit Anti-BCL2L1 can be used for western blot applications at a concentration of 1μg/ml.

Sequence

Synthetic peptide located within the following region: LVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSW

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable