SAB2109128

Anti-BSG antibody produced in rabbit

affinity isolated antibody

• Synonym(s): 5F7, CD147, EMMPRIN, M6, OK

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 42 kDa
• species reactivity (predicted by homology): bovine, human
• concentration: 0.5 mg/mL
• technique(s): western blot: 1 μg/mL
• NCBI accession no.: NM_001728
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... BSG(57396)

Description

General description

The protein encoded by this gene is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen

Synthetic peptide directed towards the middle region of Human BSG

Sequence

Synthetic peptide located within the following region: KILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEY

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable