Merck
Wszystkie zdjęcia(12)

AMAB90988

Sigma-Aldrich

Monoclonal Anti-PDIA3 antibody produced in mouse

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, clone CL2444, purified immunoglobulin, buffered aqueous glycerol solution

Synonim(y):
Monoclonal Anti-ERp60, Monoclonal Anti-ERp57, Monoclonal Anti-P58, Monoclonal Anti-GRP57, Monoclonal Anti-ERp61, Monoclonal Anti-HsT17083, Monoclonal Anti-GRP58, Monoclonal Anti-PI-PLC

Poziom jakości

100

pochodzenie biologiczne

mouse

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

antibody product type

primary antibodies

klon

CL2444, monoclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

forma

buffered aqueous glycerol solution

species reactivity

human

opakowanie

antibody small pack of 25 μL

rozszerzona walidacja

orthogonal RNAseq
RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 1 μg/mL
immunofluorescence: 2-10 μg/mL
immunohistochemistry: 1:5000- 1:10000

izotyp

IgG1

sekwencja immunogenna

PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK

numer dostępu UniProt

transport

wet ice

temp. przechowywania

−20°C

Gene Information

human ... PDIA3(2923)

Opis ogólny

Monoclonal Anti-PDIA3 Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and
PDIA3 (protein disulfide isomerase family A member 3) is also known as ERp57. It is present in the cytoplasm, nucleus and endoplasmic reticulum. ERp57 is a constituent of the multimeric spermatozoa-zona pellucida (ZP) receptor complex. This gene is located on human chromosome 15q15.

Immunogen

Protein disulfide isomerase family A, member 3

Zastosowanie

Monoclonal Anti-PDIA3 antibody has been used in immunofluorescence.
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Działania biochem./fizjol.

PDIA3 (protein disulfide isomerase family A member 3) participates in virus induced endoplasmic reticulum stress (ERS). It plays a major role in tumorigenesis. ERp57 is involved in the generation of major histocompatibility complex class I (MHC I) to impact the immunogenicity of tumor cells. It also regulates the thiol-disulphide status of proteins. PDIA3 is linked with several diseases like, cancer, prion disorders, Alzheimer′s disease and Parkinson′s diseases.

Cechy i korzyści

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST86567.

Postać fizyczna

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Kod klasy składowania

10 - Combustible liquids

WGK

WGK 1

Certyfikat analizy

Wprowadź numer partii, aby wyszukać certyfikat analizy (COA).

Świadectwo pochodzenia

Wprowadź numer partii, aby wyszukać świadectwo pochodzenia (COO).

Elena P Kolpikova et al.
Viruses, 12(3) (2020-03-07)
Zika virus (ZIKV) is an emergent member of the Flaviviridae family which causes severe congenital defects and other major sequelae, but the cellular processes that support ZIKV replication are incompletely understood. Related flaviviruses use the endoplasmic reticulum (ER) as a
The roles of protein disulphide isomerase family A, member 3 (ERp57) and surface thiol/disulphide exchange in human spermatozoa-zona pellucida binding.
Wong CW, et al.
Human Reproduction, 32(4), 733-742 (2017)
Comparative Analysis of the Interaction between Different Flavonoids and PDIA3.
Giamogante F, et al.
Oxidative Medicine and Cellular Longevity, 2016, 4518281-4518281 (2016)
Salinomycin kills cancer stem cells by sequestering iron in lysosomes.
Mai TT, et al.
Nature Chemistry, 9, 1025?1033-1025?1033 (2017)
Increased ERp57 Expression in HBV-Related Hepatocellular Carcinoma: Possible Correlation and Prognosis.
Miao L, et al.
BioMed Research International, 2017, 1252647-1252647 (2017)

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej