Wszystkie zdjęcia(2)

AV35180

Sigma-Aldrich

Anti-VDAC3 antibody produced in rabbit

affinity isolated antibody

Synonim(y):
Anti-Voltage-dependent anion channel 3, Anti-HD-VDAC3

pochodzenie biologiczne

rabbit

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

antibody product type

primary antibodies

klon

polyclonal

forma

lyophilized powder

masa cząsteczkowa

31 kDa

species reactivity

horse, bovine, zebrafish, rat, mouse, human, rabbit, pig, guinea pig, canine

stężenie

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

temp. przechowywania

−20°C

Gene Information

human ... VDAC3(7419)

Opis ogólny

VDAC3 is a member of the VDAC family which facilitates the exchange of ions and molecules between mitochondria and cytosol and is regulated by the interactions with other proteins and small molecules.

Immunogen

The immunogen for anti-VDAC3 antibody: synthetic peptide derected towards the N terminal of human VDAC3

Sekwencja

Synthetic peptide located within the following region: KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF

Postać fizyczna

Lyophilized from PBS buffer with 2% sucrose

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Certyfikat analizy

Świadectwo pochodzenia

Gui-Ying Yao et al.
Cell death & disease, 9(10), 1033-1033 (2018-10-12)
Ischemic postconditioning provides robust neuroprotection, therefore, determining the molecular events may provide promising targets for stroke treatment. Here, we showed that the expression of functional mitochondrial voltage-dependent anion channel proteins (VDAC1, VDAC2, and VDAC3) reduced in rat vulnerable hippocampal CA1

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej