Merck
All Photos(1)

AV42420

Sigma-Aldrich

Anti-MFN2 (AB2) antibody produced in rabbit

affinity isolated antibody, lyophilized powder

Synonym(s):
Anti-MARF, Anti-HSG, Anti-Mitofusin 2, Anti-KIAA0214, Anti-CMT2A2, Anti-CMT2A, Anti-CPRP1
Numer MDL:

pochodzenie biologiczne

rabbit

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

antibody product type

primary antibodies

klon

polyclonal

forma

lyophilized powder

masa cząsteczkowa

86 kDa

species reactivity

canine, chicken, zebrafish, horse, rabbit, human, bovine, mouse, rat

technique(s)

western blot: suitable

sekwencja immunogenna

ENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR

numer dostępu NCBI

numer dostępu UniProt

temp. przechowywania

−20°C

Gene Information

human ... MFN2(9927)

Immunogen

synthetic peptide corresponding to a region of human MFN2 with an internal ID of P11559

Postać fizyczna

Lyophilized from PBS buffer with 2% sucrose

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service