All Photos(1)
AV42420
Anti-MFN2 (AB2) antibody produced in rabbit
affinity isolated antibody, lyophilized powder
All Photos(1)
Synonym(s):
Anti-MARF, Anti-HSG, Anti-Mitofusin 2, Anti-KIAA0214, Anti-CMT2A2, Anti-CMT2A, Anti-CPRP1
Numer MDL:
pochodzenie biologiczne
rabbit
białko sprzężone
unconjugated
forma przeciwciała
affinity isolated antibody
antibody product type
primary antibodies
klon
polyclonal
forma
lyophilized powder
masa cząsteczkowa
86 kDa
species reactivity
canine, chicken, zebrafish, horse, rabbit, human, bovine, mouse, rat
technique(s)
western blot: suitable
sekwencja immunogenna
ENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
numer dostępu NCBI
numer dostępu UniProt
temp. przechowywania
−20°C
Gene Information
human ... MFN2(9927)
Immunogen
synthetic peptide corresponding to a region of human MFN2 with an internal ID of P11559
Postać fizyczna
Lyophilized from PBS buffer with 2% sucrose
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Certificate of Analysis
Enter Lot Number to search for Certificate of Analysis (COA).
Certificate of Origin
Enter Lot Number to search for Certificate of Origin (COO).
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service