HPA001523

Sigma-Aldrich

Anti-HSPD1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):
Anti-Mitochondrial matrix protein P1 antibody produced in rabbit, Anti-60 kDa heat shock protein, mitochondrial precursor antibody produced in rabbit, Anti-Hsp60 antibody produced in rabbit, Anti-HSP-60 antibody produced in rabbit, Anti-CPN60 antibody produced in rabbit, Anti-Heat shock protein 60 antibody produced in rabbit, Anti-P60 lymphocyte protein antibody produced in rabbit, Anti-HuCHA60 antibody produced in rabbit, Anti-60 kDa chaperonin antibody produced in rabbit
Numer w atlasie ludzkich białek:

pochodzenie biologiczne

rabbit

Poziom jakości

100

forma przeciwciała

affinity isolated antibody

antibody product type

primary antibodies

klon

polyclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

formularz

buffered aqueous glycerol solution

species reactivity

mouse, rat, human

opakowanie

antibody small pack of 25 μL

rozszerzona walidacja

independent
Learn more about Antibody Enhanced Validation

zastosowania

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

sekwencja immunogenna

RVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAEL

białko sprzężone

unconjugated

numer dostępu UniProt

wysyłka w ciągu

wet ice

temp. przechowywania

−20°C

Gene Information

human ... HSPD1(3329)

Immunogen

60 kDa heat shock protein, mitochondrial precursor recombinant protein epitope signature tag (PrEST)

Działania biochem./fizjol.

HSPD1 (60kDa heat shock protein, mitochondrial) gene encodes a molecular chaperone, a member of the chaperonin family called the heat shock protein 60. It is localized in the mitochondrial matrix, where it forms barrel shaped chaperone chambers with its co-chaperone Hsp10. The mitochondrial proteins fold efficiently inside these chambers contributing to the control of mitochondrial protein quality. Missense mutation in this gene have been linked to an autosomal recessive spastic paraplegia 13.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST84499.

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Temperatura zapłonu °F

Not applicable

Temperatura zapłonu °C

Not applicable

Jakob Hansen et al.
Journal of neurology, 254(7), 897-900 (2007-04-11)
A mutation in the HSPD1 gene has previously been associated with an autosomal dominant form of spastic paraplegia in a French family. HSPD1 encodes heat shock protein 60, a molecular chaperone involved in folding and quality control of mitochondrial proteins....
Fredrik Pontén et al.
Molecular systems biology, 5, 337-337 (2009-12-24)
Defining the protein profiles of tissues and organs is critical to understanding the unique characteristics of the various cell types in the human body. In this study, we report on an anatomically comprehensive analysis of 4842 protein profiles in 48...
Xiao-shan Li et al.
PloS one, 9(9), e107507-e107507 (2014-09-11)
Heat shock protein 60 (HSP60) is a chaperonin with essential functions for cell physiology and survival, and its expression correlates with prognosis in a number of malignancies. The aim of this study is to determine the relationship of HSP60 status...
Sylvie Bannwarth et al.
Brain : a journal of neurology, 137(Pt 8), 2329-2345 (2014-06-18)
Mitochondrial DNA instability disorders are responsible for a large clinical spectrum, among which amyotrophic lateral sclerosis-like symptoms and frontotemporal dementia are extremely rare. We report a large family with a late-onset phenotype including motor neuron disease, cognitive decline resembling frontotemporal...
Charlotte Stadler et al.
Journal of proteomics, 75(7), 2236-2251 (2012-03-01)
We have developed a platform for validation of antibody binding and protein subcellular localization data obtained from immunofluorescence using siRNA technology combined with automated confocal microscopy and image analysis. By combining the siRNA technology with automated sample preparation, automated imaging...

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.