HPA003948

Sigma-Aldrich

Anti-ITIH4 antibody produced in rabbit

enhanced validation

Ab2, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):
Anti-Inter-alpha-trypsin inhibitor family heavy chain-related protein, Anti-Plasma kallikrein sensitive glycoprotein 120, Anti-ITI heavy chain H4, Anti-GP120, Anti-MUSTN1 antibody produced in rabbit, Anti-PK-120, Anti-Transmembrane protein 110 antibody produced in rabbit, Anti-Inter-alpha-inhibitor heavy chain 4, Anti-IHRP
Numer w atlasie ludzkich białek:

pochodzenie biologiczne

rabbit

Poziom jakości

100

forma przeciwciała

affinity isolated antibody

antibody product type

primary antibodies

klon

polyclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

formularz

buffered aqueous glycerol solution

species reactivity

human

opakowanie

antibody small pack of 25 μL

rozszerzona walidacja

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

zastosowania

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

sekwencja immunogenna

LAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESRNRNVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFRRLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPA

białko sprzężone

unconjugated

numer dostępu UniProt

wysyłka w ciągu

wet ice

temp. przechowywania

−20°C

Gene Information

human ... ITIH4(3700)

Szukasz podobnych produktów? Visit Przewodnik dotyczący porównywania produktów

Immunogen

Transmembrane protein 110 recombinant protein epitope signature tag (PrEST)

Działania biochem./fizjol.

Inter-α-trypsin inhibitor heavy chain H4 is a protein encoded by the ITIH4 gene in humans. The protein is a 120kDa acute-phase glycoprotein produced primarily in the liver, secreted into the blood, and identified in serum. It is involved in liver development and stabilization of the extracellular matrix (ECM) and its expression is found to be altered in liver disease. This gene is an anti-inflammatory protein and is a substrate for plasma kallikrein (PK). It shows significant sequence identities to heavy chains (HCs) of the inter-α-trypsin inhibitor (ITI) superfamily. Its expression may be used as a biomarker that may facilitate the development of novel diagnostic and therapeutic tools.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST84483.

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Temperatura zapłonu °F

Not applicable

Temperatura zapłonu °C

Not applicable

Myung-Sun Kim et al.
Molecular bioSystems, 7(5), 1430-1440 (2011-02-19)
Recurrent pregnancy loss (RPL) is defined as at least three pregnancy losses in series prior to the 20-28 weeks of pregnancy. There are several etiological factors associated with immunology, anatomy, endocrinology, genetic, infection, chromosomal abnormalities, and environmental factors contributing to...
Rajpal S Kashyap et al.
Clinica chimica acta; international journal of clinical chemistry, 402(1-2), 160-163 (2009-03-06)
Inflammation and inflammatory markers play an important role in acute ischemic stroke (AIS). In an earlier study, we discovered a 120-kDa protein that was highly expressed in healthy participants, but either was not expressed or was barely expressed in AIS...
H Nishimura et al.
FEBS letters, 357(2), 207-211 (1995-01-03)
PK-120 is a substrate for plasma kallikrein (PK), recently purified from human plasma. Here we have established the cDNA sequence for human PK-120 mRNA. The deduced amino sequence of PK-120 revealed that it consists of 902 amino acid residues with...

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.