HPA004014

Sigma-Aldrich

Anti-SLC30A9 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):
Anti-Solute carrier family 30 (zinc transporter), member 9 antibody produced in rabbit
Numer w atlasie ludzkich białek:

pochodzenie biologiczne

rabbit

Poziom jakości

100

forma przeciwciała

affinity isolated antibody

antibody product type

primary antibodies

klon

polyclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

formularz

buffered aqueous glycerol solution

species reactivity

human

opakowanie

antibody small pack of 25 μL

zastosowania

immunohistochemistry: 1:50- 1:200

sekwencja immunogenna

HRCSWSSLCRLRLRCRAAACNPSDRQEWQNLVTFGSFSNVVPCSHPYIGTLSQVKLYSTNVQKEGQGSQTLRVEKVPSFETAEGIGAELKAPLKQEPLQVRVKAVLKKREYGSKYTQNNFITGV

białko sprzężone

unconjugated

numer dostępu UniProt

wysyłka w ciągu

wet ice

temp. przechowywania

−20°C

Gene Information

human ... SLC30A9(10463)

Immunogen

Solute carrier family 30 (zinc transporter), member 9 recombinant protein epitope signature tag (PrEST)

Działania biochem./fizjol.

Solute carrier family 30 (zinc transporter), member 9 (SLC30A9) is referred as HUEL, ZNT9, GAC63 and C4orf1. It is mapped to chromosome 4p12-p13 and encodes a nuclear protein containing the nuclear receptor interaction motif. It encodes a hydrophilic protein of 568 amino acids and molecular mass of 63,410 Da. It is ubiquitously expressed in a wide range of human fetal, adult tissues and cancer cell lines. It is essential for binding of certain coactivators to liganded nuclear receptors, as well as nuclear localization signals, a nuclear export-like signal, a zinc finger-like motif, an acidic region and two leucine zipper-like domains. It plays a crucial role during cellular replication, DNA synthesis and/or transcriptional regulation. It is a physiologically relevant part of the p160 co-activator signaling pathway that mediates transcriptional activation by Nuclear receptors (NRs).

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST86763.

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Temperatura zapłonu °F

Not applicable

Temperatura zapłonu °C

Not applicable

Del L C Sim et al.
The international journal of biochemistry & cell biology, 34(5), 487-504 (2002-03-22)
We have previously isolated and characterized a novel human gene HUEL (C4orf1) that is ubiquitously expressed in a wide range of human fetal, adult tissues and cancer cell lines. HUEL maps to region 4p12-p13 within the short arm of chromosome...
Yong-Heng Chen et al.
Molecular and cellular biology, 25(14), 5965-5972 (2005-07-01)
Nuclear receptors (NRs) regulate target gene transcription through the recruitment of multiple coactivator complexes to the promoter regions of target genes. One important coactivator complex includes a p160 coactivator (GRIP1, SRC-1, or ACTR) and its downstream coactivators (e.g., p300, CARM1...
D L Sim et al.
Genomics, 59(2), 224-233 (1999-07-20)
A 3250-bp novel human cDNA sequence was isolated from the MRC-5 human embryonic lung cell line by the rapid amplification of cDNA ends technique. This gene was designated HUEL and given the symbol C4orf1 by the HUGO Nomenclature Committee. Within...

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.