HPA007393

Sigma-Aldrich

Anti-ANXA4 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):
Anti-Chromobindin-4 antibody produced in rabbit, Anti-Annexin IV antibody produced in rabbit, Anti-Protein II antibody produced in rabbit, Anti-Annexin A4 antibody produced in rabbit, Anti-Carbohydrate-binding protein P33/P41 antibody produced in rabbit, Anti-35-β Calcimedin antibody produced in rabbit, Anti-Lipocortin IV antibody produced in rabbit, Anti-PAP-II antibody produced in rabbit, Anti-Endonexin I antibody produced in rabbit, Anti-P33/41 antibody produced in rabbit, Anti-P32.5 antibody produced in rabbit, Anti-PP4-X antibody produced in rabbit, Anti-Placental anticoagulant protein II antibody produced in rabbit
Numer w atlasie ludzkich białek:

pochodzenie biologiczne

rabbit

Poziom jakości

100

forma przeciwciała

affinity isolated antibody

antibody product type

primary antibodies

klon

polyclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

formularz

buffered aqueous glycerol solution

species reactivity

human, mouse, rat

opakowanie

antibody small pack of 25 μL

rozszerzona walidacja

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

zastosowania

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

sekwencja immunogenna

KGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQ

białko sprzężone

unconjugated

numer dostępu UniProt

wysyłka w ciągu

wet ice

temp. przechowywania

−20°C

Gene Information

human ... ANXA4(307)

Opis ogólny

ANXA4 (annexin A4) gene encodes a protein that is a member of the annexin family of calcium-dependent phospholipid binding proteins. These proteins contain divergent NH2-terminal ′head′ domain that confers specific properties to the individual annexin and a conserved 34kDa COOH-terminal protein core that binds to calcium and membrane. Annexin 4 was first identified in homogenates of human placenta. It is expressed in several tissues such as secretory epithelia in the lung, stomach, intestine, and kidney. It is associated with polarized epithelial cells.

Immunogen

Annexin A4 recombinant protein epitope signature tag (PrEST)

Działania biochem./fizjol.

ANXA4 (annexin A4) may function in the regulation of chloride ions across the epithelial membrane. It has been suggested to play a role in normal pronephrogenesis in Xenopus laevis. It has been identifies as a candidate biomarker for cisplatin resistance in malignant mesothelioma.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST70189.

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Temperatura zapłonu °F

Not applicable

Temperatura zapłonu °C

Not applicable

Karine L Massé et al.
Organogenesis, 3(2), 83-92 (2007-10-01)
Anxa4 belongs to the multigenic annexin family of proteins which are characterized by their ability to interact with membranes in a calcium-dependent manner. Defined as a marker for polarized epithelial cells, Anxa4 is believed to be involved in many cellular...
Takuya Yamashita et al.
Biochemical and biophysical research communications, 421(1), 140-144 (2012-04-14)
Mesothelioma is a highly malignant tumor with a poor prognosis and limited treatment options. Although cisplatin (CDDP) is an effective anticancer drug, its response rate is only 20%. Therefore, discovery of biomarkers is desirable to distinguish the CDDP-susceptible versus resistant...
Yi-Yao Liu et al.
American journal of cancer research, 7(6), 1285-1297 (2017-07-04)
The occurrence and progression of hepatocellular carcinoma (HCC) are affected by complicated signal transduction factors. Our previous study identified Ikaros as a novel reactivated therapeutic target that acts as a transcriptional repressor and reactivates anticancer mechanisms in HCC therapy. Annexin...

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.