HPA008609

Sigma-Aldrich

Anti-SLC6A15 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):
Anti-V7-3, Anti-FLJ10316, Anti-SBAT1, Anti-NTT73, Anti-hv7-3
Numer w atlasie ludzkich białek:

pochodzenie biologiczne

rabbit

Poziom jakości

100

forma przeciwciała

affinity isolated antibody

antibody product type

primary antibodies

klon

polyclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

formularz

buffered aqueous glycerol solution

species reactivity

human

opakowanie

antibody small pack of 25 μL

rozszerzona walidacja

recombinant expression
Learn more about Antibody Enhanced Validation

zastosowania

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
western blot: 0.04-0.4 μg/mL

sekwencja immunogenna

RELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDERPAWNSKLQ

białko sprzężone

unconjugated

numer dostępu UniProt

wysyłka w ciągu

wet ice

temp. przechowywania

−20°C

Gene Information

human ... SLC6A15(55117)

Powiązane kategorie

Opis ogólny

SLC6A15 (solute carrier family 6, member 15) gene is highly expressed in human brains, where it is especially expressed in hippocampus. Its expression is restricted to neurons. This gene is localized to human chromosome 12q21.31. The coded protein is a Na+-dependent branched amino acid transporter, which is a member of the SLC6 family of transporters.

Immunogen

Orphan sodium- and chloride-dependent neurotransmitter transporter NTT73 recombinant protein epitope signature tag (PrEST)

Działania biochem./fizjol.

SLC6A15 (solute carrier family 6, member 15) plays a role in major depression (MD), where its reduced expression is responsible for changed neuronal circuits. In unipolar depression, this protein is linked to cognitive abnormalities, and it also plays a role in the secretion of adrenocorticotropic hormone (ACTH) and cortisol.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST71167.

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Temperatura zapłonu °F

Not applicable

Temperatura zapłonu °C

Not applicable

Anna Schuhmacher et al.
The international journal of neuropsychopharmacology, 16(1), 83-90 (2012-04-06)
Major depressive disorder (MDD) is accompanied by both cognitive impairments and a hyperactivity of the hypothalamic-pituitary-adrenocortical (HPA) system, resulting in an enhanced glucocorticoid secretion. Cortisol acts via mineralocorticoid and glucocorticoid receptors densely located in the hippocampus, a brain area that...
Martin A Kohli et al.
Neuron, 70(2), 252-265 (2011-04-28)
Major depression (MD) is one of the most prevalent psychiatric disorders and a leading cause of loss in work productivity. A combination of genetic and environmental risk factors probably contributes to MD. We present data from a genome-wide association study...
Hitomi Takanaga et al.
Biochemical and biophysical research communications, 337(3), 892-900 (2005-10-18)
The SLC6 gene family comprises membrane proteins that transport neurotransmitters, amino acids, or osmolytes. We report the first functional characterization of the human SLC6A15 gene, which codes for a sodium-coupled branched-chain amino-acid transporter 1 (SBAT1). SBAT1 expression is specific to...

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.