HPA011393

Sigma-Aldrich

Anti-CHST9 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):
Anti-GalNAc-4-O-sulfotransferase 2, Anti-GalNAc-4-ST2, Anti-N-acetylgalactosamine-4- O-sulfotransferase 2, Anti-Carbohydrate sulfotransferase 9
Numer w atlasie ludzkich białek:

pochodzenie biologiczne

rabbit

Poziom jakości

100

forma przeciwciała

affinity isolated antibody

antibody product type

primary antibodies

klon

polyclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

formularz

buffered aqueous glycerol solution

species reactivity

human

opakowanie

antibody small pack of 25 μL

zastosowania

immunohistochemistry: 1:200- 1:500

sekwencja immunogenna

TGRVEKRREQKVTSGWGPVKYLRPVPRIMSTEKIQEHITNQNPKFHMPEDVREKKENLLLNSERSTRLLTKTSHSQGGDQALSKSTGSPTEKLIEKRQGAKTVFNKFSNMNWPVDIHPLNKSLVKDNKWKKTE

białko sprzężone

unconjugated

numer dostępu UniProt

wysyłka w ciągu

wet ice

temp. przechowywania

−20°C

Gene Information

human ... CHST9(83539)

Powiązane kategorie

Immunogen

Carbohydrate sulfotransferase 9 recombinant protein epitope signature tag (PrEST)

Działania biochem./fizjol.

CHST9 (Carbohydrate, N-acetylgalactosamine 4-0, sulfotransferase 9) encodes a type II, chondroitin 4-O-sulfotransferase protein belonging to the HNK-1ST (HNK-1 sulfotransferase) gene family. It is 40-42% identical with C4ST-1. It is highly expressed in the trachea including heart, liver, pancreas, salivary gland, and in testis to a lesser extent. It facilitates a critical step in the conversion of sulfate to another pituitary glycoprotein hormone, lutropin. It has been reported that CHST9 efficiently can generate sulfo-->4GalNAc β1-->4GlcNAc β1-->R in both N-glycans and O-glycans in a tissue-specific manner.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST72118.

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Temperatura zapłonu °F

Not applicable

Temperatura zapłonu °C

Not applicable

H G Kang et al.
The Journal of biological chemistry, 276(14), 10861-10869 (2001-01-15)
We have identified and characterized an N-acetylgalactosamine-4-O-sulfotransferase designated GalNAc-4-ST2 (GenBank(TM) accession number ) based on its homology to HNK-1 sulfotransferase (HNK-1 ST). The cDNA predicts an open reading frame encoding a type II membrane protein of 443 amino acids with...
N Hiraoka et al.
Glycobiology, 11(6), 495-504 (2001-07-11)
Recently, cDNAs encoding human chondroitin 4-O-sulfotransferase-1 and -2 (C4ST-1 and C4ST-2) were cloned based on their similarity to HNK-1 sulfotransferase (HNK-1ST) (Hiraoka, N., Nakagawa, H., Ong, E., Akama, T.O., Fukuda, M.N., and Fukuda, M. [2000] Molecular cloning and expression of...

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.