HPA012612

Sigma-Aldrich

Anti-CADM4 antibody produced in rabbit

enhanced validation

affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):
Anti-Nectin-like protein 4, Anti-Immunoglobulin superfamily member 4C, Anti-Cell adhesion molecule 4 precursor, Anti-TSLC1-like protein 2
Numer w atlasie ludzkich białek:

pochodzenie biologiczne

rabbit

Poziom jakości

100

forma przeciwciała

affinity isolated antibody

antibody product type

primary antibodies

klon

polyclonal

formularz

buffered aqueous glycerol solution

species reactivity

human

opakowanie

antibody small pack of 25 μL

rozszerzona walidacja

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

zastosowania

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:1000-1:2500

sekwencja immunogenna

GGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVEAQTSVPY

białko sprzężone

unconjugated

numer dostępu UniProt

wysyłka w ciągu

wet ice

temp. przechowywania

−20°C

Gene Information

human ... CADM4(199731)

Opis ogólny

Cell adhesion molecule 4 precursor (CADM4) is a 55kDa protein expressed in the kidneys, bladder, brain and prostate gland. It belongs to the tumor suppressor in lung cancer 1 (TSLC1) gene family and the gene encoding it is present on chromosome 19q13.2. CADM4 has three Ig (immunoglobulin) loops in the extracellular domain, one transmembrane domain and a short cytoplasmic domain.

Immunogen

Cell adhesion molecule 4 precursor recombinant protein epitope signature tag (PrEST)

Działania biochem./fizjol.

Cell adhesion molecule 4 precursor (CADM4) interacts by the formation of homo-dimers and its overexpression induces the aggregation of cells in a Ca2+/Mg2+-independent manner. It is thus involved in cell adhesion through homophilic trans-interaction. CADM4 suppresses tumor growth and in human proximal uriniferous tubules, its cytoplasmic region interacts with 4.1B, an actin binding protein which links CADM4 to different pathways. It mediates the contacts between Schwann cells and axons. The myelin unit establishment in the peripheral nervous system is taken care by CADM4. CADM4 interacts in cis with Erb-b2 receptor tyrosine kinase 3 (ErbB3), recruits protein tyrosine phosphatase non-receptor type 13 (PTPN13) and inhibits the heregulin-induced activation of the ErbB2/ErbB3 signaling pathway. It also interacts in cis with integrin-α6β4 and inhibits the disassembly of hemi desmosomes.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST71553.

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Temperatura zapłonu °F

Not applicable

Temperatura zapłonu °C

Not applicable

Hirokazu Sugiyama et al.
Genes to cells : devoted to molecular & cellular mechanisms, 18(6), 519-528 (2013-04-25)
Nectin-like molecule 4 (Necl-4)/CADM4, a transmembrane cell-cell adhesion molecule with three Ig-like domains, was shown to serve as a tumor suppressor, but its mode of action has not been elucidated. In this study, we showed that Necl-4 interacted in cis...
Neev Golan et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 33(27), 10950-10961 (2013-07-05)
The interaction between myelinating Schwann cells and the axons they ensheath is mediated by cell adhesion molecules of the Cadm/Necl/SynCAM family. This family consists of four members: Cadm4/Necl4 and Cadm1/Necl2 are found in both glia and axons, whereas Cadm2/Necl3 and...
Y N Williams et al.
Oncogene, 25(10), 1446-1453 (2005-11-02)
The TSLL2/IGSF4C encodes an immunoglobulin (Ig) superfamily molecule showing significant homology with a lung tumor suppressor, TSLC1. The TSLL2 protein of 55 kDa is mainly expressed in the kidney, bladder, and prostate in addition to the brain. Here, we report...
Masayoshi Nagata et al.
International journal of cancer, 130(6), 1329-1337 (2011-05-06)
Renal clear cell carcinoma (RCCC) is the most frequent subpopulation of renal cell carcinoma and is derived from the proximal uriniferous tubules. We have previously reported that an actin-binding protein, 4.1B/DAL-1, is expressed in renal proximal tubules, whereas it is...

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.