HPA012710

Sigma-Aldrich

Anti-PTPRF antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):
Anti-LAR, Anti-Tyrosine-protein phosphatase receptor type F, Anti-Leukocyte antigen-related tyrosine phosphatase
Numer w atlasie ludzkich białek:

pochodzenie biologiczne

rabbit

Poziom jakości

100

forma przeciwciała

affinity isolated antibody

antibody product type

primary antibodies

klon

polyclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

formularz

buffered aqueous glycerol solution

species reactivity

human

opakowanie

antibody small pack of 25 μL

zastosowania

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

sekwencja immunogenna

WHPPKELPGELLGYRLQYCRADEARPNTIDFGKDDQHFTVTGLHKGTTYIFRLAAKNRAGLGEEFEKEIRTPEDLPSGFPQNLHVTGLTTSTTELAWDPPVLAERNGRIISYTVVFRDINSQQE

białko sprzężone

unconjugated

numer dostępu UniProt

wysyłka w ciągu

wet ice

temp. przechowywania

−20°C

Gene Information

human ... PTPRF(5792)

Szukasz podobnych produktów? Visit Przewodnik dotyczący porównywania produktów

Opis ogólny

Tyrosine-protein phosphatase receptor type F (PTPRF) colocalizes with the cadherin-catenin complex in epithelial cells. It belongs to the LAR subfamily of transmembrane protein tyrosine phosphatases (PTPases). It contains an extracellular region, a transmembrane segment and a cytoplasmic region. The gene encoding this protein is located on chromosome 1p32.

Immunogen

Receptor-type tyrosine-protein phosphatase F precursor recombinant protein epitope signature tag (PrEST)

Działania biochem./fizjol.

Tyrosine-protein phosphatase receptor type F (PTPRF) inhibits the epithelial cell migration by preventing phosphorylation and hence the increase in the free pool of β-catenin, controlling its signaling functions. It regulates epithelial cell-cell contacts and maintains epithelial integrity at adherens junctions. The loss of function of PTPRF leads to malignant progression and metastasis. It has been shown to bind to liprin-α (SYD2) and take part in axon guidance. PTPRF also contributes to mammary gland development. In vitro, it binds to the intracellular LAR-interacting protein at the discrete ends of focal adhesion. Hence, it also has a role in regulating cell-matrix interactions.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST72042.

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Temperatura zapłonu °F

Not applicable

Temperatura zapłonu °C

Not applicable

Phosphorylation and free pool of beta-catenin are regulated by tyrosine kinases and tyrosine phosphatases during epithelial cell migration.
Muller T, et al.
The Journal of Biological Chemistry, 274(15), 10173-10183 (1999)
Coexisting amplifications of the chromosome 1p32 genes (PTPRF and MYCL1) encoding protein tyrosine phosphatase LAR and L-myc in a small cell lung cancer line.
Harder KW, et al.
Genomics, 27(3), 552-553 (1995)
A new member of the immunoglobulin superfamily that has a cytoplasmic region homologous to the leukocyte common antigen.
Streuli M, et al.
The Journal of Experimental Medicine, 168(5), 1523-1530 (1988)
Anthone W Dunah et al.
Nature neuroscience, 8(4), 458-467 (2005-03-08)
Leukocyte common antigen-related (LAR) family receptor protein tyrosine phosphatases (LAR-RPTP) bind to liprin-alpha (SYD2) and are implicated in axon guidance. We report that LAR-RPTP is concentrated in mature synapses in cultured rat hippocampal neurons, and is important for the development...
C Serra-Pagès et al.
The Journal of biological chemistry, 273(25), 15611-15620 (1998-06-23)
LAR family transmembrane protein-tyrosine phosphatases function in axon guidance and mammary gland development. In cultured cells, LAR binds to the intracellular, coiled coil LAR-interacting protein at discrete ends of focal adhesions, implicating these proteins in the regulation of cell-matrix interactions....

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

Merck

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.