SAB1405189

Sigma-Aldrich

Monoclonal Anti-DIABLO antibody produced in mouse

clone 4F9, ascites fluid

Synonim(y):
FLJ10537, SMAC3, FLJ25049, SMAC, DIABLO-S
NACRES:
NA.41

Poziom jakości

100

pochodzenie biologiczne

mouse

forma przeciwciała

ascites fluid

antibody product type

primary antibodies

klon

4F9, monoclonal

masa cząsteczkowa

antigen ~37 kDa

species reactivity

human

zastosowania

indirect ELISA: suitable
western blot: 1:500-1:1000

izotyp

IgG2aκ

białko sprzężone

unconjugated

numer dostępu NCBI

numer dostępu UniProt

wysyłka w ciągu

dry ice

temp. przechowywania

−20°C

Gene Information

human ... DIABLO(56616)

Opis ogólny

This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and it moderates the caspase inhibition of IAPs. Multiple polyadenylation sites have been found for this gene. Four alternatively spliced transcript variants have been described for this gene, with two of them encoding different isoforms and the other two probably not encoding a protein. (provided by RefSeq)

Immunogen

DIABLO (AAH11909, 119 a.a. ~ 218 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQ

Postać fizyczna

Clear solution

storage_class_code

13 - Non Combustible Solids

WGK Germany

WGK 1

Temperatura zapłonu °F

Not applicable

Temperatura zapłonu °C

Not applicable

Certyfikat analizy

Świadectwo pochodzenia

Sylvie Bannwarth et al.
Brain : a journal of neurology, 137(Pt 8), 2329-2345 (2014-06-18)
Mitochondrial DNA instability disorders are responsible for a large clinical spectrum, among which amyotrophic lateral sclerosis-like symptoms and frontotemporal dementia are extremely rare. We report a large family with a late-onset phenotype including motor neuron disease, cognitive decline resembling frontotemporal...

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej