Merck
All Photos(4)

AV32386

Sigma-Aldrich

Anti-SIRT1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-Sirtuin (silent mating type information Regulation 2 homolog) 1 (S. cerevisiae)
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

82 kDa

species reactivity

rat, dog, guinea pig, rabbit, horse, bovine, mouse, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... SIRT1(23411)

General description

Rabbit polyclonal anti-SIRT1 antibody reacts with chicken, human, mouse, rat, canine, and pig sirtuin-1 enzymes.
Sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae) (SIRT1), a member of the NAD(+)-dependent protein deacetylase SIRT family, is involved in the regulation of nuclear transcription of genes involve in energy metabolism. SIRT1 provides a link between cellular energy status sensing (NAD(+) status) and the regulation of energy homoeostasis. SIRT1 is involved in the regulation of metabolism, cell differentiation and senescence, stress response, and cancer.

Immunogen

Synthetic peptide directed towards the N terminal region of human SIRT1

Application

Rabbit Anti-SIRT1 antibody can be used for western blot applications at a concentration of 0.5μg/ml.
Rabbit polyclonal anti-SIRT1 antibody is used to tag sirtuin-1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of sirtuin-1 in NAD(+) status-dependent energy homeostasis at the level of nuclear transcription control and protein deacetylation.

Biochem/physiol Actions

SIRT1 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined;

Sequence

Synthetic peptide located within the following region: PETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKI

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service