Merck
All Photos(2)

SAB2102485

Sigma-Aldrich

Anti-TMPRSS11D antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-MGC150588, Anti-HAT, Anti-MGC150587, Anti-Transmembrane protease, serine 11D
MDL number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

46 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

General description

Transmembrane serine protease 11D (TMPRSS11D) also known as human airway trypsin or HAT encodes a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. TMPRSS11D is expressed predominantly in the respiratory tract. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. In human chromosome, the gene TMPRSS11D is located on 4q13.2.

Immunogen

Synthetic peptide directed towards the middle region of human TMPRSS11D

Biochem/physiol Actions

Transmembrane serine protease 11D (TMPRSS11D) protein may play some biological role in the host defence system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions. TMPRSS11D known to facilitate the entry of influenza viruses. TMPRSS11D is a common active proteolytic enzymes in lower female reproductive tract. TMPRSS11D expression is a key marker for squamous cell carcinogenesis and non-small cell lung cancer (NSCLC).

Sequence

Synthetic peptide located within the following region: IHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service