Merck
All Photos(6)

Documents

WH0003146M8

Sigma-Aldrich

Monoclonal Anti-HMGB1 antibody produced in mouse

clone 2F6, purified immunoglobulin, buffered aqueous solution

Sign Into View Organizational & Contract Pricing

Select a Size

Synonym(s):
Anti-DKFZp686A04236, Anti-HMG1, Anti-HMG3, Anti-SBP1, Anti-high-mobility group box 1
MDL number:
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2F6, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank® accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HMGB1(3146)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
WH0003148M5SAB1402802WH0003315M4
conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

clone

2F6, monoclonal

clone

3E5, monoclonal

clone

1G8, monoclonal

clone

3G3, monoclonal

form

buffered aqueous solution

form

buffered aqueous solution

form

buffered aqueous solution

form

buffered aqueous solution

species reactivity

human

species reactivity

human, mouse, rat

species reactivity

human

species reactivity

human

General description

High mobility group box 1 (HMGB1) is a DNA binding protein, consisting of negatively charged amino acids in C-terminus and two DNA binding motifs, called BOX A and B. HMGB1 is mapped to human chromosome 13q12.3. Necrotic cells and neuritis express HMGB1. Monocytes and macrophages upon activation release HMGB1.

Immunogen

HMGB1 (NP_002119, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFK

Application

Monoclonal Anti-HMGB1 antibody produced in mouse has been used in the detection of HMGB1 in pancreatic ductal adenocarcinogenic (PDAC) cell lines using fluorescent microscopy. and in western blotting.

Biochem/physiol Actions

High mobility group box 1 (HMGB1) functions to stabilize nucleosome and also regulates gene transcription. The phosphorylation of the nuclear localization signal in HMGB1 regulates its transport between cytoplasm and nucleus. It assists in nucleosome remodeling by eliciting chaperone functionality. Inflammation triggers high expression of HMGB1 and its inhibition may be useful for treating refractory M. pneumoniae pneumonia (RMPP). Elevated levels of HMGB1 is present in cardiovascular diseases. HMGB1 regulates autophagy in human liver cells in absence of oxygen followed reperfusion. High levels HMGB1 expression is seen in adenocarcinoma (AC), gall bladder and squamous cell/adenosquamous (SC/ASC) cancer. Polymorphisms in HMGB1 is present in oral squamous cell carcinoma (OSCC).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Yoshiyuki Suzuki et al.
Cancer research, 72(16), 3967-3976 (2012-06-16)
Although it has been shown that chemoradiotherapy may induce immunogenic cell death, which could trigger T-cell immunity mediated by high-mobility group box 1 protein (HMGB1) and calreticulin, there is still limited information to support this theory directly in a clinical
The DNA chaperone HMGB1 facilitates ACF/CHRAC-dependent nucleosome sliding
Bonaldi T, et al.
The Embo Journal, 21(24), 6865-6873 (2002)
High-Mobility Group Box 1 Protein Regulates Autophagy in LO2 Cells Following Anoxia-Reoxygenation Injury
Transplantation proceedings (2018)
Perspectives on RAGE signaling and its role in cardiovascular disease
Cohen Jr MM
American Journal of Medical Genetics. Part A, 161(11), 2750-2755 (2013)
Analysis of the released nuclear cytokine HMGB1 in human serum
Cytokine bioassays, 13-25 (2014)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service