231-102-5

Applied Filters:

Keyword:'231-102-5'

Showing 1-30 of 45 results for "231-102-5" within Products

All Photos(8)

Lithium

Synonym(s): Lithium

Linear Formula: Li

CAS No.:: 7439-93-2
Molecular Weight:: 6.94
EC No.:: 231-102-5

Compare	Product No.	Description		SDS	Pricing
	320080	ribbon, thickness × W 0.75 mm × 19 mm, 99.9% trace metals basis
	499811	granular, 99% trace metals basis
	265985	ribbon, thickness × W 0.38 mm × 23 mm, 99.9% trace metals basis
	GF47159826	foil, 25x100mm, thickness 0.6mm, as rolled, 99.9%
	265969	rod, diam. 12.7 mm, 99.9% trace metals basis

Match Criteria:EG/EC Number

All Photos(1)

Glucagon, Human

Synonym(s): Glucagon, Human

Empirical Formula (Hill Notation): C₁₅₃H₂₂₅N₄₃O₄₉S

CAS No.:: 9007-92-5
Molecular Weight:: 3482.75

Compare	Product No.	Description	SDS	Pricing
	05-23-2700	Synthetic, human glucagon. Peptide hormone secreted by pancreatic α-cells. An important hyperglycemic agent.

Match Criteria:Keyword

All Photos(1)

Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Synonym(s): Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Empirical Formula (Hill Notation): C₁₄₇H₂₃₈N₄₄O₄₂S

CAS No.:: 40077-57-4
Molecular Weight:: 3325.80

Compare	Product No.	Description	SDS	Pricing
	05-23-2101	Acts as a mitogenic factor for embryonic neurons in the sympathetic nervous system.

Match Criteria:Keyword

All Photos(1)

Calcitonin salmon

Synonym(s): Calcitonin, Salmon, Thyrocalcitonin

Empirical Formula (Hill Notation): C₁₄₅H₂₄₀N₄₄O₄₈S₂

CAS No.:: 47931-85-1
Molecular Weight:: 3431.85

Compare	Product No.	Description	SDS	Pricing
	05-23-2401	Calcitonin, Salmon, CAS 47931-85-1, is a 32 amino acid synthetic calcitonin that is shown to stimulate bone formation and inhibit bone resorption. Has ability to cross mucous membranes.
	T3660	≥97% (HPLC), powder
	C0200000	European Pharmacopoeia (EP) Reference Standard

Match Criteria:Keyword

All Photos(1)

Parathyroid Hormone Fragment 1-34 bovine

Empirical Formula (Hill Notation): C₁₈₃H₂₈₈N₅₄O₅₀S₂

CAS No.:: 12583-68-5
Molecular Weight:: 4108.71

Compare	Product No.	Description	SDS	Pricing
	P3671	≥97% (HPLC), powder

Match Criteria:Keyword

All Photos(1)

Exendin-4

Empirical Formula (Hill Notation): C₁₈₄H₂₈₂N₅₀O₆₀S

CAS No.:: 141758-74-9
Molecular Weight:: 4186.57

Compare	Product No.	Description	SDS	Pricing
	E7144	≥97%

Match Criteria:Keyword

All Photos(1)

Insulin Chain B Oxidized from bovine pancreas

Empirical Formula (Hill Notation): C₁₅₇H₂₃₂N₄₀O₄₇S₂

CAS No.:: 30003-72-6
Molecular Weight:: 3495.89

Compare	Product No.	Description	SDS	Pricing
	I1764	BioReagent, suitable for protein sequencing
	I6383	≥80% (HPLC), powder

Match Criteria:Keyword

All Photos(1)

ProteoMass^™ Insulin chain B oxidized MALDI-MS Standard

Synonym(s): Insulin Chain B Oxidized from bovine pancreas

Empirical Formula (Hill Notation): C₁₅₇H₂₃₂N₄₀O₄₇S₂

CAS No.:: 30003-72-6
Molecular Weight:: 3495.89

Compare	Product No.	Description	SDS	Pricing
	I6154	vial of 10 nmol

Match Criteria:Keyword

All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C₁₇₆H₂₇₇N₅₇O₅₅S₇

CAS No.:: 95751-30-7
Molecular Weight:: 4295.89

Compare	Product No.	Description	SDS	Pricing
	C7802	≥90% (HPLC)

Match Criteria:Keyword

All Photos(1)

Exendin Fragment 9-39

Empirical Formula (Hill Notation): C₁₄₉H₂₃₄N₄₀O₄₇S

CAS No.:: 133514-43-9
Molecular Weight:: 3369.76

Compare	Product No.	Description	SDS	Pricing
	E7269	≥95% (HPLC)

Match Criteria:Keyword

All Photos(1)

Cecropin B

Empirical Formula (Hill Notation): C₁₇₆H₃₀₁N₅₁O₄₂S

CAS No.:: 80451-05-4
Molecular Weight:: 3835.65

Compare	Product No.	Description	SDS	Pricing
	C1796	≥97% (HPLC), powder

Match Criteria:Keyword

All Photos(1)

Diabetes Associated Peptide Amide human

Synonym(s): Amylin, DAP, IAPP, Insulinoma or Islet amyloid polypeptide

Empirical Formula (Hill Notation): C₁₆₅H₂₆₁N₅₁O₅₅S₂

CAS No.:: 122384-88-7
Molecular Weight:: 3903.28

Compare	Product No.	Description	SDS	Pricing
	D2162	≥97% (HPLC)

Match Criteria:Keyword

All Photos(1)

Human glucagon

Synonym(s): Glucagon

Empirical Formula (Hill Notation): C₁₅₃H₂₂₅N₄₃O₄₉S

CAS No.:: 9007-92-5
Molecular Weight:: 3482.75

Compare	Product No.	Description		Pricing
	Y0000191	European Pharmacopoeia (EP) Reference Standard

Match Criteria:Keyword

All Photos(1)

Astressin

Synonym(s): [D-Phe¹², Nle^21,38, Glu³⁰, Lys³³]-Corticotropin Releasing Factor fragment 12-41

Empirical Formula (Hill Notation): C₁₆₁H₂₆₉N₄₉O₄₂

CAS No.:: 170809-51-5
Molecular Weight:: 3563.16

Compare	Product No.	Description	SDS	Pricing
	A4933	≥90% (HPLC)

Match Criteria:Keyword

All Photos(1)

Orexin A human, rat, mouse

Empirical Formula (Hill Notation): C₁₅₂H₂₄₃N₄₇O₄₄S₄

CAS No.:: 205599-75-3
Molecular Weight:: 3561.10

Compare	Product No.	Description	SDS	Pricing
	O6012	≥97% (HPLC)

Match Criteria:Keyword

All Photos(1)

Pramlintide acetate salt

Synonym(s): 25,28,29 TriPro-amylin (human) acetate, AC 0137, AC 137, AC0137, AC137, TriPro-amylin acetate, [Pro25,28,29]-amylin (human) acetate

Empirical Formula (Hill Notation): C₁₇₁H₂₆₇N₅₁O₅₃S₂

CAS No.:: 187887-46-3
Molecular Weight:: 3949.39

Compare	Product No.	Description	SDS	Pricing
	SML2523	≥95% (HPLC)

Match Criteria:Keyword

All Photos(1)

Parathyroid Hormone 1-34, Human

Synonym(s): Parathyroid Hormone 1-34, Human

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description	SDS	Pricing
	05-23-5501	N-terminal active peptide fragment of the native hormone that functions as a regulatory factor in the homeostatic control of Ca²⁺ and phosphate metabolism.

Match Criteria:Keyword

All Photos(1)

Chlorotoxin from Leiurus quinquestriatus (north Africa)

Empirical Formula (Hill Notation): C₁₅₈H₂₅₆N₅₂O₄₈S₁₁

CAS No.:: 163515-35-3
Molecular Weight:: 4004.76

Compare	Product No.	Description	SDS	Pricing
	C5238	recombinant, expressed in E. coli, ≥98% (HPLC), lyophilized powder

Match Criteria:Keyword

All Photos(1)

Brain Natriuretic Peptide-32 human

Synonym(s): BNP-32

Empirical Formula (Hill Notation): C₁₄₃H₂₄₄N₅₀O₄₂S₄

CAS No.:: 124584-08-3
Molecular Weight:: 3464.04

Compare	Product No.	Description	SDS	Pricing
	B5900	≥97% (HPLC), powder

Match Criteria:Keyword

All Photos(1)

Urodilatin human

Synonym(s): Thr-Ala-Pro-Arg-Atrial Natriuretic Peptide

Empirical Formula (Hill Notation): C₁₄₅H₂₃₄N₅₂O₄₄S₃

CAS No.:: 115966-23-9
Molecular Weight:: 3505.93

Compare	Product No.	Description	SDS	Pricing
	U5754	≥97% (HPLC)

Match Criteria:Keyword

All Photos(1)

Calcitonin Gene Related Peptide human

Synonym(s): α-CGRP, CGRP-I

Empirical Formula (Hill Notation): C₁₆₃H₂₆₇N₅₁O₄₉S₂

CAS No.:: 90954-53-3
Molecular Weight:: 3789.31

Compare	Product No.	Description	SDS	Pricing
	C0167	≥95% (HPLC), powder

Match Criteria:Keyword

All Photos(1)

Cecropin A

Empirical Formula (Hill Notation): C₁₈₄H₃₁₃N₅₃O₄₆

CAS No.:: 80451-04-3
Molecular Weight:: 4003.78

Compare	Product No.	Description	SDS	Pricing
	C6830	≥97% (HPLC), powder

Match Criteria:Keyword

All Photos(1)

Neuropeptide Y human

Synonym(s): NPY, hNPY

Empirical Formula (Hill Notation): C₁₈₉H₂₈₅N₅₅O₅₇S

CAS No.:: 90880-35-6
Molecular Weight:: 4271.68

Compare	Product No.	Description	SDS	Pricing
	N5017	≥95% (HPLC), powder, synthetic

Match Criteria:Keyword

All Photos(1)

Glucagon-Like Peptide I human

Synonym(s): GLP-1, Preproglucagon 72-108

Empirical Formula (Hill Notation): C₁₈₆H₂₇₅N₅₁O₅₉

CAS No.:: 87805-34-3
Molecular Weight:: 4169.48

Compare	Product No.	Description	SDS	Pricing
	G3265	≥97% (HPLC)

Match Criteria:Keyword

All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	SML1150	≥98% (HPLC)

Match Criteria:Keyword

All Photos(1)

Defensin HNP-2 human

Synonym(s): Neutrophil Peptide-2

Empirical Formula (Hill Notation): C₁₄₇H₂₁₇N₄₃O₃₇S₆

CAS No.:: 99287-07-7
Molecular Weight:: 3370.95

Compare	Product No.	Description	SDS	Pricing
	D6790	≥95% (HPLC)

Match Criteria:Keyword

All Photos(1)

Proinsulin C-Peptide (55-89) human

Synonym(s): Proinsulin connecting peptide

Empirical Formula (Hill Notation): C₁₅₃H₂₅₉N₄₉O₅₂

CAS No.:: 11097-48-6
Molecular Weight:: 3616.99

Compare	Product No.	Description	SDS	Pricing
	C4999	bioactive peptide hormone

Match Criteria:Keyword

All Photos(1)

Margatoxin

Synonym(s): MgTx

Empirical Formula (Hill Notation): C₁₇₈H₂₈₆N₅₂O₅₀S₇

CAS No.:: 145808-47-5
Molecular Weight:: 4178.95

Compare	Product No.	Description	SDS	Pricing
	M8278

Match Criteria:Keyword

All Photos(1)

[des-His¹, Glu⁹]-Glucagon amide

Empirical Formula (Hill Notation): C₁₄₈H₂₂₁N₄₁O₄₇S

CAS No.:: 110084-95-2
Molecular Weight:: 3358.65

Compare	Product No.	Description	SDS	Pricing
	G1651	≥97% (HPLC)

Match Criteria:Keyword

All Photos(1)

Vasoactive Intestinal Peptide human, porcine, rat

Synonym(s): VIP

Empirical Formula (Hill Notation): C₁₄₇H₂₃₈N₄₄O₄₂S

CAS No.:: 40077-57-4
Molecular Weight:: 3325.80

Compare	Product No.	Description	SDS	Pricing
	V6130	synthetic, ≥95% (HPLC), powder
	V3628	≥95% (HPLC), powder

Match Criteria:Keyword

Page 1 of 2

231-102-5

Lithium

Glucagon, Human

Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Calcitonin salmon

Parathyroid Hormone Fragment 1-34 bovine

Exendin-4

Insulin Chain B Oxidized from bovine pancreas

ProteoMass™ Insulin chain B oxidized MALDI-MS Standard

Charybdotoxin

Exendin Fragment 9-39

Cecropin B

Diabetes Associated Peptide Amide human

Human glucagon

Astressin

Orexin A human, rat, mouse

Pramlintide acetate salt

Parathyroid Hormone 1-34, Human

Chlorotoxin from Leiurus quinquestriatus (north Africa)

Brain Natriuretic Peptide-32 human

Urodilatin human

Calcitonin Gene Related Peptide human

Cecropin A

Neuropeptide Y human

Glucagon-Like Peptide I human

SNX-482 Recombinant

Defensin HNP-2 human

Proinsulin C-Peptide (55-89) human

Margatoxin

[des-His1, Glu9]-Glucagon amide

Vasoactive Intestinal Peptide human, porcine, rat

ProteoMass^™ Insulin chain B oxidized MALDI-MS Standard

[des-His¹, Glu⁹]-Glucagon amide