The product is a polyclonal antibody and binding sites are not determined. However, the immunogen sequence is as shown below.
CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLA
| Size/SKU | Availability | Price |
|---|
rabbit
unconjugated
affinity isolated antibody
primary antibodies
polyclonal
Prestige Antibodies® Powered by Atlas Antibodies
buffered aqueous glycerol solution
human
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:500-1:1000
CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLA
wet ice
−20°C
unmodified
human ... MUC5B(727897)
1 of 1
This Item | |||
|---|---|---|---|
| biological source rabbit | biological source rabbit | biological source rabbit | biological source rabbit |
| Quality Level 100 | Quality Level 100 | Quality Level 100 | Quality Level 100 |
| antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form affinity isolated antibody |
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies |
| clone polyclonal | clone polyclonal | clone polyclonal | clone polyclonal |
Try our Product Selector Tool to narrow your options
10 - Combustible liquids
WGK 1
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Choose from one of the most recent versions:
Find documentation for the products that you have recently purchased in the Document Library.
The product is a polyclonal antibody and binding sites are not determined. However, the immunogen sequence is as shown below.
CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLA
Helpful?